SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000008713 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000008713
Domain Number 1 Region: 1399-1504
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 4.5e-31
Family Lipoxigenase N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 13-154
Classification Level Classification E-value
Superfamily C-type lectin-like 3.44e-29
Family C-type lectin domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000008713
Domain Number - Region: 265-340
Classification Level Classification E-value
Superfamily PKD domain 0.000222
Family PKD domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000008713   Gene: ENSGALG00000005435   Transcript: ENSGALT00000008727
Sequence length 2478
Comment pep:known_by_projection chromosome:Galgal4:11:14882016:14915308:-1 gene:ENSGALG00000005435 transcript:ENSGALT00000008727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGITVLISLAVYLAMEEATDEEGIPCSKHQLAFNHSCYEFVRLQRTFTSAQRWCERGGGH
LVFIENEETQEFLQKHIAEDQEWWIGLISDSLLNETTDGSMIWLDTSNVSYSNWYKDQPS
PFSSTCGYILKNAKYQWGVTENCSQEFDFICEFENGQSIACDNYNATVQCGSGEVIQIGE
SFYGRKTPHYCVLETPPQNDTEEDCSWISIKDEVAGQCHGLQACQVAADGTFFGDPCPAS
GSYLFIQYYCKEGLQLVVTDTCFIFENITITLNWLLSPYSGNLSCIISTGDGHTVDPYYP
LTLLSNVTHRYTSPGEFAVFVECSTSEWHVTAQKQVMVQDKMDELSITGCYSHHESGNSS
QCRTLYGELLWIQAELNGGSGVTYVVLANNMTLIESSAKEGIAPHNLTLDSAAQELLGPG
MHQLEIRVSSNTTASEISESIAVHLIEPVSGLWAVLASHTLQLGENLEINVSMSHGAPAK
MRFEVVGLNETHSHQEDCPQGEPQTYIIPMHSEGTFLVKVMAMNAFSNVSLDIGFINVLA
NSSHKEKDTSKTNTQMTKGHQRKNKIHIKPSRHVDPFTTITLGWPDNNDNSSFLWSCGAC
WPEWDECVQHQMILTSQQEVQIPPSCLPPPKSAVTVRVTVRSHGNEERQDEQCLYVTATT
VLLPYRCEANCKPVNASEEVVLSVSGQKDSQDMYYNWYLDNTFQNKSAPLPPACSLTGFR
QNSLNLLQSNTSTLIMNSSFLQMHGEAFQIKVTALTQRGYGEQTYLVSTVPPPQVPSCAV
SPKQGSVLTTFTVSCSTPCSVDSCQSSHSTQLNYCFYLNSNSLLHCGPDPELFPVYLPLG
EEEDNFILHVTITVSNSFGDTVHTNASVKVIQADTIDGNLTLQTIVSEKANTILRDGNNS
MSLFQLFKSVTSVLNHETQEENSNISLQTDTRKELRGLMLTTLSAVNVTSVQTALKMSEV
LKDITYRTEELSVSAQVEASNTLKDVSASLLTVNTEDSRDDQKLMDAASYLFNAVSNVLQ
ASIQNRAMNTTVPEAEQSLVSHQLLNTVENLQSALLFGKEPDDEPMVLTAHSATMYINRL
QTENMDGTSINISSSSSASFTLPTASSLGISGVDDETVDIRMVSFAMNPFFSSDTSFDIS
GTLGGLSLTGLDGLIIPVSNLKENIEIILPRHSAPQEDRIQLNLGNFSIFQVNITSENTS
IVIQLECEHDIPLILYLGYGYRPNETNYDMKSHLFYKKTTGGETNTWVLSPEELIFGEGP
YYFMVSQDMGMDSTVYDGLAIAVTCFASRCVFWDEQQGNWNSYGCQVGPKTNSRSTQCLC
NHLTFFGSSFFVIPNAVDVSRTAQLFGTFVDNPVVVTTVGCIFLIYVLVVIWARRKDIQD
DAKAKITVLEDNDPFAQYRYLVTVFTGHRRGAATTSKVTLTLYGLEGESEPHHLTDPDTP
VFERGGVDVFLLCTLFPLGELQSIRLWHDNSGDNPSWYVNRVLVHDLAWDQKWYFLCNSW
LAVDIGECVLDKVFPVATEQDMKQFSNLFFMKTSKGFQDGHIWYSVFSRSPRSSFTRAQR
VSCCFSLLLCTMLTSIMFWGVPKDPAEQKMDLGKIEFTWQEVMIGFESSLLMFPINLLIV
QIFRNTRPRPAMQGTEKKPGKNGRVSPGLPPPPQVTPAISLTPEAVIKDIRRIANSLFKA
LKAPSLTSVSDLEKSTNINTLLALVEDIICQQNRAGQEFYDESKKKDDPVTVTLGPMDIQ
EKTRSPTPEKGMCERLKHSDYNRCLYMQLQRVEMELELLGPHKFQMPQSYTQAVRQVQHM
KNLLQNQICSSASISFSGDGKKSSSKGLPWWFVFIAWFLVAATSGVSGFFTMLYGLHYGK
ENSIKWLISMAISFFESLFITQPLKVLGFAAFFALVLKKVEHEDEENTAIDGPLPAPGNS
NPLFGARRDSRSNIYQPPPAADVEKMKISCMKEQKAFALIREILAYLGFLWMLLLVAYGQ
RDPNSYYLNKHIESSFTEGFHDVYSYEDFFTWAKTTLVKNLYGSYKGFITDGNSKLVGSA
RIRQVRVKGDSCPISPILQRVIQECHAPYSLQTEDTSDYGEHWNTSVFDISSDLSSAWHY
QSQSKLRGQPVWGKLAIYGGGGYVIHLGTDPQNASRILQYLFNSVWLDTFTRAVFVEFTV
YNANVNLFCIVSLMFETNALGAFFTSAELQSVRLYPYTNTLHIFVVAAEVIYFLFIVYYM
MVQGKLMKALKWRYFHSKWNLLEMAIILISWSALSVFVKRTILGSRDISYYQEHKEDSVS
FNETARADAVLGYLIAFLVLLSTVKLWHLLRLNPKLNMITSTLRRAWGDISGFITVIAIM
FLAYSIATNLIFGWKLCSYKTLSDSAETMVSLQLGIFNYEEILDYNPILGSLLIGSCIVF
MTFVVLNLFISVILVAFSEEQKHYQPSEEEEIVDLMLMKLFGFFGIKCKQEEKTGCNNQP
KQPPDGSEPRRADMAAPP
Download sequence
Identical sequences ENSGALP00000008713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]