SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000009064 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000009064
Domain Number 1 Region: 22-125
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.44e-29
Family Hormone receptor domain 0.0000235
Further Details:      
 
Domain Number 2 Region: 100-379
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000375
Family Rhodopsin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000009064   Gene: ENSGALG00000005657   Transcript: ENSGALT00000009078
Sequence length 412
Comment pep:known chromosome:Galgal4:2:4196306:4292028:1 gene:ENSGALG00000005657 transcript:ENSGALT00000009078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVTISQFILEEFDVNCSLLDLQETVLESFSISFLGFHGLYCNATTDQIGTCWPRASAGK
LVERPCPEFFNGIKYNTTKNAYRECLGNGTWASKINYSQCEPILDDKRKYAHHYKIALII
NYLGHCISVGALIVAFMLFLCLRSIRCLRNVIHWNLITTFILRNVMWFLLQMIDHNIHES
NEPWCRCITTVYNYFVVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPCPII
VAWAIGKLYYENEQCWFGKEPGKYIDYIYQGPVILVLLINFVFLFNIVRILMTKLRASTT
SETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDISQIVFIYFNSFLQSFQGFFVSVFY
CFLNGEVRSAARKRWHRWQDHHSLRVRVARAMSIPTSPTRISFHSIKQTAAV
Download sequence
Identical sequences F1NGG4
9031.ENSGALP00000009064 ENSGALP00000009064 ENSGALP00000009064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]