SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000009551 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000009551
Domain Number 1 Region: 11-127
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-24
Family DEATH domain, DD 0.0038
Further Details:      
 
Domain Number 2 Region: 161-281
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.97e-24
Family Toll/Interleukin receptor TIR domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000009551   Gene: ENSGALG00000005947   Transcript: ENSGALT00000009565
Sequence length 375
Comment pep:known chromosome:Galgal4:2:4800977:4813594:1 gene:ENSGALG00000005947 transcript:ENSGALT00000009565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVPVGAGSAPGPEPADLHSVPMVALNYGVRRRLGLYLNPRAATAADWTALAEKLGHDY
LEIRRLEALPDPTAALLEEWQSRCPGGATVGQLLELLRQLGRHDVLLELGGSVEEDCKKY
LRRKQQEAEQPLQVPAVDSSVPKTSELMGITTRDDPYGHGTEMFDAFICYCQKDLQFVQE
MIRELEQTEFKLKLCVFDRDVLPGTCVWSISGELIERRCRRMVVVISDDYLESDECDFQT
KFALSLSPGARLKRLIPVKCKTMKNEFPSILRFITICDYTNPCTKMVLDKTGKISLAAVM
QSFESFFSICPGCAFGPRCSYSISLQNVDPRSQRLEPAAGSKEFSVALFHNLEGEIEQLC
GCSYLIQRAIASSTW
Download sequence
Identical sequences A0A1L1RJR5
ENSGALP00000009551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]