SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000009661 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000009661
Domain Number 1 Region: 470-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000143
Family Classic zinc finger, C2H2 0.0019
Further Details:      
 
Domain Number 2 Region: 700-755
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000152
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 78-128
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000428
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 4 Region: 519-547
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000303
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 609-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000865
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 763-788
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000114
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 7 Region: 561-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000845
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000009661
Domain Number - Region: 134-166
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00266
Family Classic zinc finger, C2H2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000009661   Gene: ENSGALG00000006013   Transcript: ENSGALT00000009675
Sequence length 885
Comment pep:novel chromosome:Galgal4:20:9800881:9833823:1 gene:ENSGALG00000006013 transcript:ENSGALT00000009675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSYACKGGRKTAGSTKPSKDSRAEARLNPPAELPRLALHSDLRGLKVMQWSEICFSPG
NATSDKTEGKKKGRPKAENQALKDIPLPLMNQWKDEFKAHSRVKCPNSGCWLEFPSIYGL
KYHYQRCQGGAISEKLTYSCSYCEAAFSSKTQLEKHRLWNHLDRPVPASKTENKVQKAIG
KSSGKKRYRAASGLCGSGIGMAGSLHSRGLGLGVTSPLCFALELLRVQLAPPSIPNRQRR
KKPCPRIMLRMVNARRRAGRARSFRSPQPRLLQLPPPRQSPRVARMVGSRGAARPHCRRK
TPRFTPMVSCNSEFHCELKMGCSYGRGISVVPVGQGWAGPGHGYPYRSMGLHCLQLPSKP
APNTLALVKAPWGDPFPPDMECVHSPGPGTAEIHLAVKSGRKQKTPKKFTGEQPSISGTF
GLKGLVKAEDKAKAHRAKKLEGSTNMEELKKKPPGAGVKKASSGVTPPSSLSPANLEDQW
QREISEKGEVACPTCSVITRKTVVGLKKHMDVCQKLQDALKCQHCKKQFKSKAGLNYHTM
AEHVSKPVPVETAALGEQEERERLRKVLKQMGKLKCPNEGCVANFSSLMGYQYHQKRCGK
QLAEADKPVFSCPHCGKKYKSKAGHDYHVRSEHPASPPEEPEVKPEPTPVEDFERTPSGR
IRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPETKRLNYTRPGLPKLNPRLLESWK
NEVKEKGHINCPNNCCEAIYSSVSGLKAHLANCNKGEHSVGKYRCLLCQKEFSSESGVKY
HIIKAHSENWFRTSSETTRKKKNREQLSSSKEEKKKSTNGKKRGRKPKERPLETSLKSKE
SVAAKTNHKKSPEHWEGSRCSSDGDERGPKAPNQRKGGGSKVPEK
Download sequence
Identical sequences ENSGALP00000009661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]