SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000010443 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000010443
Domain Number 1 Region: 37-504
Classification Level Classification E-value
Superfamily Sema domain 9.68e-132
Family Sema domain 0.0000157
Further Details:      
 
Domain Number 2 Region: 1350-1477,1673-1862
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-52
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 953-1035
Classification Level Classification E-value
Superfamily E set domains 3.08e-16
Family Other IPT/TIG domains 0.056
Further Details:      
 
Domain Number 4 Region: 1035-1139
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000196
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.047
Further Details:      
 
Domain Number 5 Region: 852-947
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000196
Family Other IPT/TIG domains 0.0045
Further Details:      
 
Domain Number 6 Region: 507-559
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000196
Family Plexin repeat 0.0014
Further Details:      
 
Domain Number 7 Region: 806-839
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000275
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 8 Region: 1136-1224
Classification Level Classification E-value
Superfamily E set domains 0.0000778
Family E-set domains of sugar-utilizing enzymes 0.077
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000010443
Domain Number - Region: 651-682
Classification Level Classification E-value
Superfamily Plexin repeat 0.034
Family Plexin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000010443   Gene: ENSGALG00000006473   Transcript: ENSGALT00000010457
Sequence length 1892
Comment pep:known_by_projection chromosome:Galgal4:1:2226706:2647006:1 gene:ENSGALG00000006473 transcript:ENSGALT00000010457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAMWKWTCLVSHLLLSATVSPLGRQQPPHSKRPFITFTGDQTEGNFNHLVVDERTGHI
YLGAVNRIYKLSSDLKVLVTHQTGPDDDNPKCYPPRIVQTCNEPLTPTNNINKMLLIDYK
ENRLIACGSLYQGICKLLRLDDLFKLGEPFHKKEHYLSGVNESGSVFGVIVSYSNMDDKL
FIATAVDGKPEYFPTISSRKLTKNSEADGMFAYVFHDEFVASMIKIPSDTFTIIPDFDIY
YIYGFSSGNFVYFLTLQPEMISPPGSTTKEQVYTSKLVRLCKEDTAFNSYVEVPIGCEKN
GVEYRLLQAAYLSKAGAILARSLGVGPEDDILFTVFSKGQKRKMKSLDESALCIFVLKEI
NDRIKDRLQSCYRGEGTLDLAWLKVKDIPCSSALLTIDDNFCGLDMNAPLGVSSMVRGLP
IYTEDGDRMTSVIAYVYKNHSLAFVGTKSGKLKKIRVDGTTKNTLEYEIVQVVDTGPILR
DMAFSMDHEHLYIMSEKQLTRVPVESCSQYETCSECLGSGDPHCGWCVLHNTCTRKERCE
RSSEPRRFASEMKQCVRLTVHPNNISVSQYNVLLVLETYNVPELSAGVNCTFEDLSEMDG
LVVGSQIQCISPAAKEVPQIITENGDHHIVQLQLKSKETGMTFASTSFVFYNCSVHNSCL
SCVESPYRCHWCKYRHVCTHDPSTCSFQEGRVKLPEDCPQLLQAEKILVPVEVIKPITLK
AKNLPQPQSGQRGYECILNIQGNEQRVPALRFNSSSVQCQNTSYSYEGMEINSLPVELTV
VWNGNFNIDNPAQNKVHLYKCGAMRDSCGLCLKADPDFECGWCEGQNQCTLKQHCPAQDS
QWLELSSTKGKCTNPKITDINPVTGPREGGTKVTIRGENLGLEFTDIASHVKVAGVECKP
LVEGYIPAEQIVCEMGEAKPSQHAGFVEICVAECKPEFMARSSQLYYFMTLTLSDLKPKR
GPVSGGTQVTITGNNLNAGSNVIVTFGRQPCLFYRRSTKHIVCNTTASDEGFEKVKVSVR
VDKAKIHQELQYEYVEDPTILRIEPEWSIFSGNTPIAVWGTHLDLIQNPQIRAKHGGKEH
VNNCEVQNSTEMTCQAPALAVDPNNQSELAERPEEFGFILDNVQSLLILNKTNFTYYPNP
IFEVFNPSGILELKPGSPIILKGKNLIPPVAGGNAKLNYTVLVGEKPCVVTVSDVQLLCE
SPNLIGRHKVMARVGGMEFSPGMVYISPDSPLSLPAIVSIAVAGGLLIIFIVAVLIAYKR
KSRESDLTLKRLQMQMDNLESRVALECKEAFAELQTDIHELTSDLDGAGIPFLDYRTYTM
RVLFPGIEDHPVLRDLEVPGYRQERVEKGLKLFAQLINNKVFLLSFIRTLESQRSFSMRD
RGNVASLIMTVLQSKLEYATDVLKQLLADLIDKNLESKNHPKLLLRRTESVAEKMLTNWF
TFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDSITGEARYSLSEDKLIRQQIDYKTLVL
SCVNPDNVNSSEIPVKILNCDTITQVKEKILDAIFKNVPCSHRPKAADMDLEWRQASGAR
MILQDEDITTKIENDWKRLNTLAHYQVPDGSVVALVSKQVTAYNAVNNSTVSRTSASKYE
NMIRYTGSPDSLRSRTPMITPDLESGVKMWHLVKNHEHGDQKEGDRGSKMVSEIYLTRLL
ATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHNIHDPHVRHTWKSNC
LPLRFWVNMIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAK
DIPSYKNWVERYYSDIAKMPAISDQDMNAYLAEQSRMHMNEFNTMSALSEIYSYVGKYSE
EILGALDQDDQAGKQKLAYKLEQVITLMSIDS
Download sequence
Identical sequences ENSGALP00000010443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]