SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000010609 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000010609
Domain Number 1 Region: 8-136
Classification Level Classification E-value
Superfamily Hormone receptor domain 2.09e-28
Family Hormone receptor domain 0.00015
Further Details:      
 
Domain Number 2 Region: 131-409
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000119
Family Rhodopsin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000010609   Gene: ENSGALG00000006575   Transcript: ENSGALT00000010623
Sequence length 439
Comment pep:known chromosome:Galgal4:2:9612723:9663652:-1 gene:ENSGALG00000006575 transcript:ENSGALT00000010623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNLPILLLLSLSWNLGRVNGVHPECRFHLEIHKEEAKCMELLKHAKPVDYKGCVGVWDN
ITCWRPAKIGETVTVPCPKIFSLVSGKPGNISKNCTSNGWSDIFPDIFSTCGYNDYEDDY
KVNFYVRVKAIYTLGHSVSLIALTTGSIILCLFRKLHCTRNYIHLNLFLSFILRAISVLV
KDDILYSSSNTAHCPEDQTSWVGCKAILVFFQYGVMANFYWLLVEGLYLHILLVLIFSPN
RHFTVYLLIGWGIPTIFIITWTVTRIILEDTGCWDTNEHGGPWWVIRIPILISIIVNFIL
FISIIRILLQKLRSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYTVFALFPDRSSNNYKII
FELCLGSFQGLIVAVLYCFLNSEVQGELKRKWRSLCWKQTAGRDYRLHSSISRNGSESVS
QLHRNSRAQSFMQTETTMI
Download sequence
Identical sequences Q56IA1
ENSGALP00000010609 9031.ENSGALP00000010609 ENSGALP00000010609 NP_001014970.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]