SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000011305 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000011305
Domain Number 1 Region: 3991-4053
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000173
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 2 Region: 2791-3017
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000201
Family Extended AAA-ATPase domain 0.055
Further Details:      
 
Domain Number 3 Region: 2435-2563,2601-2690
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000484
Family Extended AAA-ATPase domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000011305   Gene: ENSGALG00000006988   Transcript: ENSGALT00000011319
Sequence length 5205
Comment pep:known_by_projection chromosome:Galgal4:18:9771940:9818172:-1 gene:ENSGALG00000006988 transcript:ENSGALT00000011319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPTCLHVPGEGPSCAQCGAQPTAGAGDQAAERGEVNLVPDPDAGPEPEGEPREESAGG
PPSTTETEEEEEEEEGGTLQEGITALSSASETAPECTAAELSSATERKEEEEEKEGGASL
LEDVAALCDVSETDPQHVAGGSSRKSKRKNRKTNRGKKSRSGHGEQDSLPPGSTAPAQAA
DLSDECVVSQEIQTSSGEVAKQSADLIASDSGGAQENGSAVGRLGREAEGLEVVSGGGHC
SAAVMNPLESSTGSGAATAPGSAALKEMGGGGSTAQRGARSGVEERSAASDAGQALETKR
DSQSLGGKKKPASVGERTDVSSGISPDIEVPKSKAATSKAERPSQDTKTSLVAQSSKAGK
GKQESSQKVSSSPSSEKGTMEKKTPNERAQETSEKTKKTKATNQTDGPLVRKNNAPSVTD
KGKEKHQQNNQKPVDKEKRSEGVTVYFHAILSKDFKLNPETDKVFVVSGGFYGSAQWEKI
CEMSCVKRLDVHGYLIEGYAILPIENVDKFIPYKYWISSGEGEYEFIYKKQAVDIVNRCL
YVSSNLINNREWHQYDDIVCRKPSMVKSLWSFLQDKTKDVVEGKKIAAEIMLENIFSILG
TWNPINMRNFLFQLRQFHVVAAHPSVYDGAYMPWIELGFGMQQVNDLLLQYMRKIASSFL
LPEGAEASQKGVVMKSKLALGLTLLTIVDAFQLPASKEDLAGLCELLCLEKSQKAVVDEF
HQTMEVFASSVSIFSFRIQLINLCQRCIDGKVGQWVWILPLLHLCTAPMQCDRCPMEEEI
WAGLEGLPFAEARKNHNARALLQLMKEKKYLMELDTTLVKSWMCVLPTESLAEFIEDVCG
DLLISLQGVSYRLQNAAPSCKKPEVVGRLVKTLLCLLDGERARALQARSWLSCLFLCFKL
HASVCTCTKRVLEFKVPATSAMLIAKLARLQPTEQVLGDETALENEVVEILSEALRCTRS
WFKSALSQKLLKESHHHVMFTFNAELEAWNEFVKISFPDEQFNARWKSTLLADLERRIQE
EDPVNQILAYCCQQHRLRDLDRSIGCCFETCAIEAVTAACQTQSSLLDMISSYNMDQFSR
LISTIIVKSWPRKVERSQDDFDEILHHLLTWPDVKHIFTFNGTNTKLQEQLTNEARIVMA
KADSVFMSVTNELQEGSILIKHLEEIFQHENQFVFIWELKHKQLLDGQKELLRQLKEVLQ
RRREELTHIMAEKKAIGTFLNMCRKVQASVTVYVGEVDRQHSEDLRSEKLNRVVSVGRRP
IQTYYKLSQELKECAQKMHAFKDSLIFQQFWEEAAMKAREKYGSSDEEEVVPGVDLNDVF
EGLIAPCFMNYERLYDDLRSGSLTLSAVDRIFQDFTNHPEDIKAELNIICELRPAEGRRW
VDRRFQQIQQYHEMHLTFDAVKIIANVKESLNLSGDFSVLENLLYMTEKLESHKTQKLDF
ISSELIHAKELLQGITVNRQGCLRELAQQKEFVCWVREALKDINELKVFVDLASISAGEN
DMDVDRVACFHDTVHGYSSLLYELSQESGFNDFMLCLRKLWRALDTDENLPKKLRASAQH
LEWLKTVKESHGSVELSSLSLAATINSRGVYILKAPADGRKVSLDNVLHLTLLESSENHR
PSWKYSLAELRELQNKLMLMSAKGEQGLEVEKFSETFSNVQRLAQAFIDLYSAGNMLFRS
WLAHVHCSPKSELCVLIDFTLRLIPELEGQGELADVLPRLCKTMESFLESWQSFMSKKRF
QHFYLNFYTAEQLVYLCTELGQGQPSQKALMMLSFLKSNCTAEDVLRASEGHEPPSSTKA
VSDLLALLDEERDLTTCLEYIWECYMSNMGAFLPNCLDVDTLGAWLKSLAGGERECVTRG
FPQDLLHVGQPNLITCPRSEVLTSALAVYMNSPNQPLPTFDEVLLCTPQTTAEQVGLFLR
RCLIPGSEGEKIYTMLFADELSYDVSCRAEELFQHLQGYNSTYRLIILCNCEREHCYIPS
VFSQYKVHMIPQRPLTEIQQYLQHHYRVAQPSNSAAGVFKGSTCVGIVSSKRAGVGKSLY
VKRLHERLEAQQPDCTELLKTIRLIEPAVDEDKVLQSLLPFLESQQPTKPMIFHFDITSS
VQSGVPEFLFKLLVLQYLTDANGNMWLRQKCHLYVIEILEVSPLPQQTVSVSQKYNFLDV
FPKVMCKSPKEVLEMETLKRQPRDASDPGMDEEEFHSEAFQRPFQYLRRFDNGHNLDTFW
YKAHSVEGSPAECLQVFLLHCGIVDPSWSELRNFTSFLNVQLRDCEASVFCNPEFVQDTL
QGFKNFVVTFMILMARDFATPSLHISDQSSGRQSFNLEDVSEEDLLPFRIRKKWESEHHP
YLFFNGDRVSMTFIGFHFQPNGAHGVDAINPLNGKVIKRNIMSSQLYHGLLLQRVPFDVS
FDSLSRLEKLDRLCMVLGIPYVTDPDETYELTTDNVLKMLAIEMRFRCNIPVVIMGETGC
GKTRLVNFLCKLRRSFVEVENMKLVKVHGGTTAEMIYARIKEAEALAIANKKQHGLDTVL
FFDEANTTEAVSSIKEVLCDHTVEGKPLVPCSGLQIIAACNPYRKHTPKMIQRLELAGLG
YRVKADETKEKLGSIPLRQLVYRVHALPPSMIPLVWDFGQLNNLTEKMYIQQIVQRVTEH
IRVDQAEVKVIAEVLIVSQQYMRQRDDECSFVSLRDVERCMEVFKWFYKRSDLLLGELEK
YLEKRALKSPERNNVIWSLVLAVGVCYHASLEKKEAYRNAISKVLPKPYDTQKKILEEIS
VMQDLFLSGVHLRDTIARNLALKENVFMMVICIELKIPLFLVGKPGSSKSLAKTIVADAM
QGQAAHSDLFKDLKQIHLVSFQCSPLSTPEGIIGTFKHCARFQDGKNLEEYVSVVVLDEI
GLAEDSPKMPLKTLHPLLEDGCIDDDPLPHKKVGFIGISNWALDPAKMNRGIFVSRGDPS
KEELIESAKGICCSARGALHKVEQYFHHFANAYEIICKAQDREFFGLRDYYSLIKMFFAL
VKSSKSEPTPRDIAEVVLRNFSGKDDINALEIFTSQLPEKGEVNAHDISRIELIRQNIYS
SSEDGDCRYLLVLTENYAALQILQQAFFTARQQPEIIFGSSFPKDQEYTQICRNINRVKV
CMETGQMVVLLNLQNLYESLYDALNQYYVYLAGQKYVDLGLGTHRVKCRVHPKFRLIVIE
EKDVVYKHFPIPLINRLEKHYLDISTVLDKEQRETVKELKKWVRDFVAVNTREHLVNQQN
YSPSDVFVGYHSDTCASVVLQTTERLKAACPPSQLMARVKAEAQLALLNCATPDSVIRLC
NSGGLFRTDSLANVYFKQQQHSSFADFLRAHIRSGSECQTVFTEITTFSRLLTSADSACL
EREVQGKAQRPQILFLQQFDTEYSFLKGIRDFLEATSGNKVLIIQADFEDGSQNAQLVAS
AKYTVVNEINKANLGEASVFVYFIMKLSRVEGGTSYVGFHGGLWQSVHIDDLRRSKDMIS
DMSVLQNLTISQMLCDDSAPPANGEEEEEEREGEAEASVPEAEHCEGEVLDIVVLLRSCV
QSAVGMLRDQNENLSRSRRRIEILLSLLSKEDGLKASFLKTTRARLSSLLKKQEENSFQP
KNWVLRAASNLSALQEAGTFRHTLWKRVQKAITQFLALLIAVIDRNGNLELLARPASEWV
TNLWMFIFSDTKLLTVPSGVGKNSSQTEIILVQNSMMVSADAGNKMPFSWRIKEYLDEMW
LKAQYIQSTEDQAENFVDIFQKTALGEFISALTEGERQELFQCYVIDFIVLTIGVSSTKE
LQCLQLAFLSCIEEWKAASPRRQEAMPCLPWVHLGYNQFKSRLQNFSRILAVHPSVVDPL
LNVKEDGVPHSKMVADILAAIVCAEELENHMQAAPPEVWLQKVKNLQMPIEFICKDKSLQ
RSDVRCHQLLKQLQTCWDRVFCMSLFVEHVLLGTSALMPEVENIVKKHTLLLARCFEENS
DMKTRPTFVAVMKVLCKCKEDVSSRLYRYDLKQCSICHGEPKDPVQLCCNHAFCEKCIRA
WLIPAHMHCPLCRVAVEDDNLTVNKELSAAIAKNALFRQRCNNFFIDVVTTMCFKDNEPP
DTAVIQELLSLLFVYRGLLGDSDRPAAYTKLLSPFDEEVDETPVIRSVMLKLLLKYSFSE
VKNDVQDYLCRVEHSCILDKRDKKELYLLFVNCLEDSTRDKSEGSLGCERVNSLPGDRGF
PENYLPKSNQGAPQESSVEYLQAVAKVRLYLTKAAELLYDLHELPEQDQVEEKKRYLENV
KVFCDLTRNDWHRVYLVRKIAHLYGMEFAQKLVMEARFNWVFPVEILRQVRHSQSNHIDR
YLVCGKNYKALRDAVGKVMIECKPQGLLEAEKASGSTTAVRSVHLLLAVFREVTALYGFS
DSSFHPKQQQTRALTEFIQNSKALSPPDLQNFATSLVMNALPSVLSVDPQSFSSNGALIE
MAVHTMAVLLCGQNPILRPLRNLAFSPHTMERAFLPTMPEDMVAQARAWEGLANLRMYIC
PNGHPCTVGECGRPMEIGRCIECGLQVGGLKYKAVPGFQEFRSGEDRTQTGHILGDAQHR
RGQGVSDRSMSPVVFVLIRLLTHLTMLLGATKDPQSLRNIIKPPVRNPVTFLQQHIQEDL
AQLTRILGKSVDETINILHLVLGSLLKDPHQHPRQWPVEFDGVLSTKQKRNKWEEIVANT
VIIPELEGLDKKLVMLNKQIQEDERISSNPIVKVVYGDPVTFLSQLPKDSHIHHSKMWSS
RKRISVENLGHVVQQMNAKDTVPLLWKFLQKEPELRLVKYLPEILALQRDLVRLFQNSSD
VKRCTIREFLSEPLSDVMWVLLERRVDVFLSVWNKLRSSLDTNGEVKLPKGYCDADLTLD
SKLEVLLPRRQGLGLCSTALVSYLIGLQNDFIHLVNKHIKEDARYLISPSEVADLHLISY
EVERDLIPLILSNCQYSMEKGGETLQHFDLERIQQQVISKFLQGKPLITLTGIPTLVYRH
DRNYEELFNDIRNKQGLHQSALPSSVMNAISGELQSYSDVCDALFVTEIALEFLAMAGEN
TEMLLTDYIENVLQMGDQTNPHVLQALRRCHLKHIIALWQLLSTHKSEQLLRLRRDPFED
ISTEYKADLSPEMAKLLHTYLVHSRLETFLQELHKMIILKLKRVRSVDEFRPAWGLKESL
IPLLDEKDFELAEELQDAFPDEIHLSHTAATWKAAAAFKRERREN
Download sequence
Identical sequences ENSGALP00000011305 XP_015151085.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]