SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000014614 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000014614
Domain Number 1 Region: 656-812
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-35
Family MAM domain 0.0018
Further Details:      
 
Domain Number 2 Region: 815-970
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-30
Family MAM domain 0.00093
Further Details:      
 
Domain Number 3 Region: 973-1135
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-30
Family MAM domain 0.0034
Further Details:      
 
Domain Number 4 Region: 67-229
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-23
Family MAM domain 0.0084
Further Details:      
 
Domain Number 5 Region: 278-429
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-20
Family MAM domain 0.017
Further Details:      
 
Domain Number 6 Region: 491-646
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000522
Family MAM domain 0.029
Further Details:      
 
Domain Number 7 Region: 456-496
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000262
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 8 Region: 236-274
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000014614   Gene: ENSGALG00000008995   Transcript: ENSGALT00000014630
Sequence length 1222
Comment pep:known_by_projection chromosome:Galgal4:17:555005:565821:-1 gene:ENSGALG00000008995 transcript:ENSGALT00000014630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLLPACLLALSGWATLMALLSMGSRAAAVNSCGSVAEHRCDFVCHCGDCSDENQCGYLGI
SAVLGSPFTCDFEDDDCGWRDVSTSTYRWVRGRASLDSWGTGPHSDHTMGTDQGWFMVTV
SPPAKATATAWLQSPVMQEATATCEIWASYHLSGSGLNQTACPTLRLAVAFGDTVVELWR
SPEHRAEGWHQLVAYPGRIKGQFQLTFALTQPPACGAVLALDDIVFRNCGLLAGQQSCGA
EESSCSRGSCLALGRFCDGTDDCGDGSDEDAEQCQFFTFCSFEEDLCSWEVEAGQPTWER
NTSVGLGTTSGVPTRDHSTNSATGYFLHTVAGGAVSVARLSSPTFQATNSCSLVLYCHLH
GSATSSLRISYVINSTEHLVRERTGDTGSCWVRERVDFNLKESFKVLITGEAGSGGSVAV
DDLILSPGCVLQQGDLGLLASDSAPVALPGRARASNCVAEEFSCDDGGCVSAELVCDFAK
ACADGSDENHCGTTTFEEGAGGWHDTSVGQLRWAVQRATEPTATALVGAVPCPGAFLALQ
RGEGQMVAPAKARTPLLGPSGLACAMEMSYRLHSGAQGFLAVAVTEHSTDMTHLAWHTRG
HGSTAWEHVHIPLGERARPFQVELLGMAELQDPEAIAIANVTFVQCNPGVEPPEAAELSC
NFEADLCGWYPDRGSDFQWVRSTGQGQGSDHTTGSGYFLAVDPSAPWSRGQHAQLITYRQ
EPAAAPQCLAFWYRLAGPQIGTLSLKLQLQGAEETVLWTQRGSQGSVWHRGLATLPATGQ
QRYRWQLAFEALRDGFVGDMALDDVALTPGACGAELSCSFEAGACGLAGSGQWHWQSGGT
SITTGPMADHTTGTTTGHYMVVNTSKHSLPMGHVATLSSALYQRSAPAQCLAFWYQLSAA
APGTLSILVEENGEQRKLFSISAMEGDTWHRGHVTVRADTDWKVVFEAVGAGSERSYMAL
DDLRVSDGACPEPASCDFEWDTCGWSSPSDERLHGFTWGWKSGVPLAKYPGPEQDHTLGT
EDGHYVHFDTRVLGAGGTAARLESQHLPATTAGCLRFWYHMDIPEHLTGGELQVKLQSAA
GQHTAWSVAGQRSQGWQSSTVPLESPSEFQIVFEITSRMWPMDGTVALDDIEYSATGGCD
SNLEAPGKVKSSSSFVAEVVVGLLLAVIVLALVAAGGRYWLKRRAQESGMAMESNTPQGF
DNITFQDDKVIIAQVPKERDED
Download sequence
Identical sequences ENSGALP00000014614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]