SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000015337 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000015337
Domain Number 1 Region: 106-390
Classification Level Classification E-value
Superfamily L domain-like 1.79e-49
Family Ngr ectodomain-like 0.0065
Further Details:      
 
Domain Number 2 Region: 246-259,412-713
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.39e-45
Family Rhodopsin-like 0.00069
Further Details:      
 
Domain Number 3 Region: 31-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000034
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000015337   Gene: ENSGALG00000009429   Transcript: ENSGALT00000015353
Sequence length 763
Comment pep:known_by_projection chromosome:Galgal4:4:21328064:21376386:1 gene:ENSGALG00000009429 transcript:ENSGALT00000015353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSDWCFYIFLLIGTKVIRDSLEDPVSRGGAACPLGYFPCGNITKCLPQQLHCNGEDDCG
NHADEDNCEDNNGWSLQFDKHYTLDKMKSLYAFQTKTPECLAGAVPVECKCQGLEVFCDA
AKLRDVPLVPSNITTMSLQKNLLRKLYADVFRKYQDLKNLYLQDNKIRAVSKHAFKGLYN
LTKLYLSNNKITNLKPRVFEDLHKLEWLIIENNRINRISPSTFYGLKSLILLDMMNNSLA
HLPDKPLCQYMPRLNWLDLEGNHIHHLRNVTFISCSTLTVLVMRQNKISSLNENSFSSLQ
MLDELDLASNEIESLPAYVFKDLKELSQLNLSYNPIKKIQIDQFDFLTKLKSLSLEGIEI
ANIQRRMFIPLRNLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQRVFVWVV
SAITCFGNIFVICMRPYIRSENKLHAISIMSLCCADCLMGIYLFVIGAFDLKYRGEYNKH
AQLWMDSIHCQLVGSLAILSTEVSVLLLTYLTLEKYICIVYPFRCLKPRKCRTISILVLI
WVIGFAVAFIPLSNKEFFRNYYGTNGVCFPLHSEQSESSGSQIYSVVIFLGVNLAAFLII
VFSYGSMFYSVHQTAIMATEIQNHIKKEMILAKRFFFIVFTDALCWIPIFILKLLSLLQV
EIPGTITSWVVIFILPINSALNPLLYTLTTRPFKEMIHQFWYNYRQRRSKRGKGSQKAYG
PSFIWVEMWPMHEITPKLTKPVLCTDSSDASVTTQSTRLNSYT
Download sequence
Identical sequences F1NY48
ENSGALP00000015337 XP_420385.2.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]