SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000016362 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000016362
Domain Number 1 Region: 30-148
Classification Level Classification E-value
Superfamily Hormone receptor domain 4.19e-29
Family Hormone receptor domain 0.0016
Further Details:      
 
Domain Number 2 Region: 112-421
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000146
Family Rhodopsin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000016362   Gene: ENSGALG00000010078   Transcript: ENSGALT00000016381
Sequence length 459
Comment pep:known chromosome:Galgal4:3:28650945:28730284:-1 gene:ENSGALG00000010078 transcript:ENSGALT00000016381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVAPAVPLVLLLAAAGRAAPARRSTDGSLSGVVQKWKEYQLQCLKYLYEAPPIAAEGKF
CNRTFDNYACWPDGLPGTYVNVSCPWYLPWANTVLHGQVYRFCTSEGTWLLKENSTLPWR
NLTECEASDQDAPEEQLLNLSIIYTIGYALSFSALVIATAILLGFRHLHCTRNYIHLNLF
TSFILRAISVFIKDSVVKWMYSTATQEHQWEGLISFQESLSCRLVFVMMQYCVAANYYWL
LVEGMYLYTLLVLSVFSEQRIFRLYLCIGWGVPMLFVILWGTVKYLYEDEGCWSRNYNMN
YWLIIRLPILIAIGVNFLIFIRVICIIISKLQANLMCKTDIKCRLAKSTLTLIPLLGTHE
VIFAFITDEHARGMLRFVKLFTELSFASFQGLMVAILYCFINNEVQMEFRKSWERWRLEH
LYVQRDSSMKPLKCPANSISSGGTVGSSVYAATCQATFS
Download sequence
Identical sequences B4ZY91
ENSGALP00000016362 NP_001129023.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]