SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000016481 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000016481
Domain Number 1 Region: 127-392
Classification Level Classification E-value
Superfamily vWA-like 9.89e-89
Family Trunk domain of Sec23/24 0.000000835
Further Details:      
 
Domain Number 2 Region: 8-66,409-517
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 6.41e-66
Family beta-sandwich domain of Sec23/24 0.0003
Further Details:      
 
Domain Number 3 Region: 621-761
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 9.68e-57
Family C-terminal, gelsolin-like domain of Sec23/24 0.00000481
Further Details:      
 
Domain Number 4 Region: 518-620
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 1.83e-47
Family Helical domain of Sec23/24 0.00000733
Further Details:      
 
Domain Number 5 Region: 49-123
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 2.49e-21
Family Zn-finger domain of Sec23/24 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000016481   Gene: ENSGALG00000010150   Transcript: ENSGALT00000016500
Sequence length 765
Comment pep:known_by_projection chromosome:Galgal4:5:36843282:36865890:-1 gene:ENSGALG00000010150 transcript:ENSGALT00000016500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTFLEFIQQNEDRDGVRFSWNVWPSSRLEATRMVVPVAALFTPLKERPDLPPIQYEPVL
CSRTTCRAVLNPLCQVDYRAKLWACNFCYQRNQFPPTYAGISEMNQPAELLPQFSSIEYV
VQRGPQMPLIFLYVVDTCMEDEDLQALKESMQMSLSLLPPTALVGLITFGRMVQVHELGC
EGISKSYVFRGTKDLSAKQLQEMLGLTKVAVSQVGRGPQVQQPPPSNRFLQPVQKIDMNL
TDLLGELQRDPWPVPQGKRPLRSSGVALSIAVGLLECTFPNTGARIMMFIGGPATQGPGM
VVGDELKLPIRSWHDIEKDNAKYVKKGTKHFEALANRAAANGHVVDIYACALDQTGLLEM
KCCPNYTGGYMVMGDSFNTSLFKQTFQRVFTKDMQGQFKMGFGGTLEIKTSREVKISGAI
GPCVSLNSKGPCVSENEIGTGGTCQWKICGLNPTTTLALYFEVVNQHNAPIPQGGRGAIQ
FVTQYQHSSGQRRIRVTTVARNWADAQTQIQNIAASFDQEAAAILMARLAVYRAETEEGP
DVLRWLDRQLIRLCQKFGEYHKDDPSSFRFSETFSLYPQFMFHLRRSPFLQVFNNSPDES
SYYRHHFMRQDLTQSLIMVQPILYAYSFNGPPEPVLLDSSSILPDRILLMDTFFQILIYH
GETIAQWRKSGYQDMPEYENFHHLLQAPIDDAQEILHSRFPMPRYIDTEHGGSQARFLLS
KVNPSQTHNNMYAWGQESGAPILTDDVSLQVFMDHLKKLAVSSAA
Download sequence
Identical sequences A0A1D5P0E2
ENSGALP00000016481 ENSGALP00000016481 9031.ENSGALP00000016481 XP_003206639.1.16129 XP_004941832.2.86415 XP_015720545.1.68032 XP_015720546.1.68032 XP_421250.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]