SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000019294 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000019294
Domain Number 1 Region: 809-999
Classification Level Classification E-value
Superfamily Nucleotide cyclase 3.92e-63
Family Adenylyl and guanylyl cyclase catalytic domain 0.00012
Further Details:      
 
Domain Number 2 Region: 33-427
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.39e-55
Family L-arabinose binding protein-like 0.00087
Further Details:      
 
Domain Number 3 Region: 507-774
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.7e-48
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000019294   Gene: ENSGALG00000011838   Transcript: ENSGALT00000019319
Sequence length 1072
Comment pep:known_by_projection chromosome:Galgal4:1:48801436:48846720:-1 gene:ENSGALG00000011838 transcript:ENSGALT00000019319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQRMLGLALWLLFLSLQLLQQVGSSRCNNNNYMINVMLMPDSDFPSTSENLTSAVEEAL
STIQNELETEGVKVTVNASFHHFRSSLYVSQGCRTSTCEGVELIKQIFENGTLGCAVIGP
ACTYATYQMVSVETIPSLPLISVGSFGLSCDYKENLTRLLTPARKVNDFFYYFWNEIQQP
FKTSTWESVYLYKKTDNSEQCLWYMNALDAGVTQFSEKLKFKDIVRTQDQFRRLVKNPKR
KSNVIIMCGTPADIRQDLGTETVDKDIVIILIDLFKNTYFRNTTSARYMQNVLVLTLPPA
NNNFSTRTTDTSLLEDDFVIGYYNAVLLFGHILKKFIFSQSPVLPTSFINEFRNITFEGA
QGPVTLDEFGDIDNNLTLLYTTQSASDPQYRVLMYFNTQENDTYVVSTSPDFIWKSHRLP
SDIPSTGPHILTIAVFTLAGIVILVLIISLLVLRKYRRDNERRRKKWSHISPEKILPLET
SETNHVSLKIDEDKRRDTTQRLRQGKYDKKVVILKDLKNNDGNFTEKQKIELNKLLQIDY
YNLTKFYGTVKMDTMIFAVIEYCERGSLRDVLNDKISYPDGTFMDWEFKISVMYDIAKGM
SYLHSSKTEVHGRLKSTNCVVDNRMVVKITDFGCNSILPQRKDLWTAPEHLRHADVSQKG
DVYSYGIIAQEIILRKETFYTRHCQDTKEKLYRVENDKGMKPFRPDLSLETVGEREMEVY
TLVKSCWEEDPEKRPDFKKIENILAKIFSNYHGQTNESYMDTLIRRLQLYSRNLEHLVEE
RTELYKAERDRADRLNFMLLPRPVVKSLKETGLVEPEFFEEVTIYFSDIVGFTTLCKYST
PMEVVDMLNDIYKNFDHILDHHDVYKVETIGDAYMVVSGLPKRNGNRHAVDISMMALDIL
SFIGSFELRHLPGLPVWIRIGIHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPLR
IHVSGSTVAILKRTDCRFQYEMRGETYLKGRGTEITYWLTGTEDKEYNLPTPPSVENQQQ
LKDDIAEMITKILQKRETEGYRTSEIKRVASYRTGTLEYLQLASTDNSATYL
Download sequence
Identical sequences E1BZE2
XP_416207.3.86415 ENSGALP00000019294 9031.ENSGALP00000019294 ENSGALP00000019294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]