SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000019506 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000019506
Domain Number 1 Region: 27-143
Classification Level Classification E-value
Superfamily C-type lectin-like 4.19e-16
Family Link domain 0.018
Further Details:      
 
Domain Number 2 Region: 133-193
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000445
Family Complement control module/SCR domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000019506   Gene: ENSGALG00000011973   Transcript: ENSGALT00000019532
Sequence length 618
Comment pep:known_by_projection chromosome:Galgal4:2:45087235:45129827:-1 gene:ENSGALG00000011973 transcript:ENSGALT00000019532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGSRRSSLTFARAVGPVFFILQIISVRADGKVFALQSKNNSQGLDLAEAEKACVDLSA
RLATAEELKRAVLDCSFIGCTTGWLADGTAGTIICRKTGSKQQSVKAIDVKIETDPFVND
QYDAFCVKDEDKPCGDPPSFPHTILHGHTGFEMGDELLYVCAQGYVMGNKETAFTLLCDS
CGEWYGQVQACVKDETEAHIDYEDNFPDDRSIPIAENEHANGKEEIEQEQLSFSKKSEEG
RTGSTKGVTQDIDTSEKGSRAPTESPVSLLSQKNLFWFPSEAFSEPESEKGTDDSTKAHF
SEGDNHIGVKTVYDEPGAKMFYDSEDFPIGPILTANDTKEEIDAVPITDESWLDGYPVTQ
EVVEDDEEEGDKVDGSMGTEEDIILTTDQPNHVEVRKLGDGSPAPEEGLTQIVAATTSID
DERVKETPVPLTSVSGLEDLSVSRGYDDAAWDHPTTALETVTQEPVTTVLLDITSLRTSV
SETSVMASPFDHTTEEEAKGTTAYPAQVATTAPAPDIPTDTSSPELDEQENLTQGLGEKP
VPTSEPCEGEDCPRSSKGAVIAVIVILLCLLLAAAVLAVWFFKKRQQKNSVYKLNGRCQP
RHHCYHHYHHQHIEMQKV
Download sequence
Identical sequences A0A1D5PQR8
ENSGALP00000019506 XP_418822.3.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]