SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000019893 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000019893
Domain Number 1 Region: 9-301
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.4e-48
Family WD40-repeat 0.0031
Further Details:      
 
Domain Number 2 Region: 1002-1064
Classification Level Classification E-value
Superfamily HMG-box 0.0000000000746
Family HMG-box 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000019893   Gene: ENSGALG00000012199   Transcript: ENSGALT00000019920
Sequence length 1123
Comment pep:known_by_projection chromosome:Galgal4:5:56194399:56224761:1 gene:ENSGALG00000012199 transcript:ENSGALT00000019920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSEQKPMRYGHTEGHTDVCFDDSGSCIVTCGSDGDVRIWENLDDDDPKSINVGEKAYSC
ALKNGKLITAVSNNTVQIHTFPEGAPDGILTRFTMNANHVVFNSDGAKIAAGSSDFMVKV
VEVADSSKQKTFRGHDAPVLSLSFDPMDIYLASASCDGSVRVWKVEDQTCVTNWLLLQKC
NDVINAKSICRLAWQPGSGKLLAIPVDKVVKLYRRETWDNQVDLSDTSITQPLNVVVWSP
CGQYLAAGSVNGSIVVWKVETRECTERMKHEKSYSICGLAWHPRYEQIAYTDTEGNLGLW
EDIGDGKKPNDKVASTVTKDYEDLFDGDDDDYLNGDMIEPPSSPNTGANEDHGDDDDLMP
TSGHPRRAIIDDDDNSLDIGMIKANSNLLEKEEDDDDQIGGFPALPTSSTQQPFYDGPRP
TPRQKPFQSGSTPVHLMHRFMVWNSVGIIRCYNDEQDNAIDIEFHDTSIHHATHLPNSLN
HTMADLSTEAILLACESTEELASKLHCIYFSSWDANKEWTVDMPKDEDIEAICLGQGWAA
CATSALLVRLFTVGGVQKEIFCLPGPVVSMAGHGEQLMVIYHRGTGFDGDQCLGVQLMEL
GKKKKQILHGDPLSLTKKSYLVWVGFSAEGTPCYVDSEGIVRMLNRGLGNTWIPVCNTRE
HCKGKSDHYWVVGIHENPQQLRCIPCKGARFPPTLPRPAVAILPFTLPYCQVTTEKGQME
EQYWRSVVFHNYVDYLSKNGYELDENAKSQPVKEQQELLMKLFALSCKLEREFRCVELAD
LMTQNVVNLAIKYASRSRRLNLAQRLSEMAVEKASELATALEDEEEEEEEDFRTHLNAGY
STSATEWGRLPGRSAQQDQEMEEAEETNGYEEAEGTPEVPKQRPNPFSKAVSSAEVITPK
SAVIASSSQGRVNPFKVSSNKKDPLVPSSNVLDTMSKYSKKISSSRAVNKQSSPVIKPLI
PKPKSKQASAASFFQVRTPGSSEKRVGEREEKAGHEPPEVQVTAQDNTENKRPKTGFQMW
LEENRANILTDNPDLNEAEVIKEGMSRFRILSSEERMVWTEKAKGGAVTDLTEDKKRKRP
TAAEDEAKKNEEQKSEDSNVSKKKKPLDQATNVRLSSFAFKQS
Download sequence
Identical sequences XP_015143411.1.86415 XP_421449.4.86415 ENSGALP00000019893 9031.ENSGALP00000019893 ENSGALP00000019893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]