SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000019928 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000019928
Domain Number 1 Region: 841-925
Classification Level Classification E-value
Superfamily DEATH domain 7.85e-24
Family DEATH domain, DD 0.0000465
Further Details:      
 
Domain Number 2 Region: 168-260
Classification Level Classification E-value
Superfamily Immunoglobulin 8.73e-17
Family I set domains 0.022
Further Details:      
 
Domain Number 3 Region: 259-310
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000034
Family TSP-1 type 1 repeat 0.00056
Further Details:      
 
Domain Number 4 Region: 313-367
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000275
Family TSP-1 type 1 repeat 0.00074
Further Details:      
 
Domain Number 5 Region: 62-164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000168
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000019928   Gene: ENSGALG00000012219   Transcript: ENSGALT00000019955
Sequence length 931
Comment pep:known chromosome:Galgal4:4:58208189:58447083:-1 gene:ENSGALG00000012219 transcript:ENSGALT00000019955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKGLEGTAARCGLGMGYLLHSVVLPALAVLGASRPGSAAQDDDFFHELPETFPSDPPEP
LPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHVVDERVDETSGLIVR
EVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSL
EQEVLLQCRPPEGIPVAEVEWLKNEEVIDPVEDRNFYITIDHNLIIKQARLSDTANYTCV
AKNIVAKRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGFQKRTRTCTNPAPLNGGAFCE
GQNVQKIACTTLCPVDGKWTSWSKWSTCGTECTHWRRRECTAPAPKNGGKDCEGLVLQSK
NCTDGLCMQAAPDSDDVALYVGIVIAVIVCLAISVVVALFVYRKNHRDFESDIIDSSALN
GGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIK
VYNTSGAVTPQDELSDFSSKLSPQITQSLLENETLNVKNQSLARQTDPSCTAFGTFNSLG
GHLVIPNSGVSLLIPAGAVPQGRVYEMYVTVHRKEGMRPPVEDSQTLLTPVVSCGPPGAL
LTRPVVLTMHHCAEPNMDDWQIQLKHQAAQGPWEDVVVVGEENFTTPCYIQLDPEACHIL
TETLSTYALVGQSITKAAAKRLKLAIFGPLSCSSLEYSIRVYCLDDTQDALKEVLQLERQ
MGGQLLEEPKTLHFKGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHIWSGCQRNLHCT
FTLERFSLNTLELVCKLCVRQVEGEGQIFQLNCSVSEEPTGIDYPIMDSAGSITTIVGPN
AFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLKLDRYLNYFATKSSPTGVILDLWEAQN
FPDGNLSMLAAVLEEMGRHETVVSLAAEGNY
Download sequence
Identical sequences F1NIC0
NYSGRC-IgSF-Q7T2Z5 ENSGALP00000019928 9031.ENSGALP00000019928 ENSGALP00000019928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]