SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000021168 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000021168
Domain Number 1 Region: 349-404,433-637
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.02e-39
Family PhyH-like 0.079
Further Details:      
 
Domain Number 2 Region: 65-177
Classification Level Classification E-value
Superfamily ARID-like 5.23e-30
Family ARID domain 0.00067
Further Details:      
 
Domain Number 3 Region: 287-349
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.88e-17
Family PHD domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1138-1222
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000197
Family PHD domain 0.0081
Further Details:      
 
Domain Number 5 Region: 1602-1662
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000332
Family PHD domain 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000021168
Domain Number - Region: 816-915
Classification Level Classification E-value
Superfamily YacF-like 0.0654
Family YacF-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000021168   Gene: ENSGALG00000012986   Transcript: ENSGALT00000021199
Sequence length 1692
Comment pep:known_by_projection chromosome:Galgal4:1:60371020:60416706:-1 gene:ENSGALG00000012986 transcript:ENSGALT00000021199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGGGSRYAAEFVPPPECPVFEPSWEEFSDPLGFIGRIRGLAEKTGICKIRPPKDWQPP
FACEVQSFRFTPRIQRLNELEAMTRVKLDFLDQLAKFWELQGSNLKIPVVERKILDLYGL
SKIVAGKGGFEVVTKEKKWSKVASRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
IQKPNLNLKEKVEAEDLSSDAQTSPKQGSRMNVVLKRTRRVKSQVEAGEMSRNTELKKLQ
IFGAGPKMMGLSLGAKDKEDEVTRRRKGNRSEAFGMQMRQRKGTLSVNFVDLYVCLFCGR
GNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECNKPREAFGFEQAVREY
TLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSG
FPVKDGRRKLMPEEEDYALSGWNLNNMPILEQSVLAHINADISGMKVPWLYVGMCFSSFC
WHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEDVMKELAPELFESQPDLLHQLVTIMN
PNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVSH
YRRLGRHCVFSHEELIFKMAADPECLDVGLAAMVCKEMTLMIEEETRLRETVVQMGVLMS
EEEVFELVPDDERQCTACRTTCFLSALTCSCNPERLVCLYHPSDLCPCPMQNKCLRYRYP
LEDLPSLLYGVKVRAQSYDTWVSRVTEALSANLNHKKDVIELRVMLEDAEDRKYPENDLF
RKLRDAVKEAETCASVAQLLLSKKQKHSRQSQDSGRTRTKLTMEELKAFVHQLFSLPCVI
SQARQVKNLLDDVEEFHERAQEAMMDEVPDSSKLQELIDMGSGLYVELPELPRLKQELQQ
ARWLDEVRSTLLDPQRVTLDVMKKLIDSGVGLAPHHAVEKAMAELQELLTVSERWEEKAK
VCLQARPRQSMMALEGIVNEAKNIPAYLPNVLALKEALQRARDWTAKVEAIQNGNNYAYL
EQLENLSAKGRPIPVRLDALPQLESQVAAARAWRERTGRTFLKKNSSYSLLQVLSPRTDI
GVYGSSKNRRKRAKELMEKEKEKDLDLESLSELEDGLEEARDTAAVVAIFKEREQKEIEA
MHTLRAANLAKMTMVDRIEEVKFCVCRKTASGFMLQCELCKDWFHSSCVPLPKTSSQKKG
SSWQAKEVKFLCPLCMRSRRPRLETILSLLVSLQKLPVRLPEGEALQCLTERAMSWQDRA
RQALATDELSSALAKLSVLSQRMVEQAAREKTEKIISAELQKAAANPDLQGHLTSFQQSA
FNRVIGSVSSSPRQTLDYDDEETDSDEDIRETYGYDIKDNASVKSSSSLEPNLFCDEEIP
IKSEEVVTHMWTAPSFCAEHAYSSASKSCSQGSSTPRKQPRKSPLVPRSLEPPVLELSPG
AKAQLEDLMMVGDLLEVSLDETQHIWRILQATHPPSEDRFLHVMEDDSMDEKPLKMRGRD
SSERKRKRKLERAEQFFGDMKQKSKELKKLEKPKKKKLKLTMDKTKELNKLAKKLAKEEE
RKKKREKAVVAKVELAKESTEKKREKKVLDIPSKYDWSGAEESDDENAVCAAQNCQRPCK
DKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCAKKTMQGPSSPAHAPPPSFLLS
YKLPMEDLKETS
Download sequence
Identical sequences ENSGALP00000021168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]