SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000021271 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000021271
Domain Number 1 Region: 10-412
Classification Level Classification E-value
Superfamily Sema domain 8.76e-126
Family Sema domain 0.00000023
Further Details:      
 
Domain Number 2 Region: 760-818
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 3.79e-17
Family TSP-1 type 1 repeat 0.0002
Further Details:      
 
Domain Number 3 Region: 706-757
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000127
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 4 Region: 517-567
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000379
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 5 Region: 408-460
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000576
Family Plexin repeat 0.0047
Further Details:      
 
Domain Number 6 Region: 572-623
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000222
Family TSP-1 type 1 repeat 0.00067
Further Details:      
 
Domain Number 7 Region: 819-864
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000051
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 8 Region: 461-514
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000017
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000021271   Gene: ENSGALG00000013051   Transcript: ENSGALT00000021302
Sequence length 896
Comment pep:known_by_projection chromosome:Galgal4:2:78760824:78897005:1 gene:ENSGALG00000013051 transcript:ENSGALT00000021302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFPAFLTNFCWLQAVEWQCDEATKRACYSKGKSKEECQNYIRVLLVGGNHLFTCGTNAFT
PICTNRTLNNLTEIHDQISGMARCPYSPQHNSTALLTSSGELYAATAMDFPGRDPAIYRS
LGALPPLRTAQYNSKWLNEPNFVSSYDIGNFTYFFFRENAVEHDCGKTVFSRAARVCKND
IGGKFVLEDTWTTFMKARLNCSRPGEIPFYYNELQSTFFLPELDLIYGIFTTNVNSIAAS
AVCVFNLSAITQAFNGPFKYQENSRSAWLPYPNPNPNFQCGTMDQGLYVNLTERNLQDAQ
KLLMHEVVQPVIPIPYFMEDNSRFSHVVVDVVQGKDMLFHIIYLATDYGTIKKVLAPMNQ
TSSSCLLEEIELLPKSQREPIRSLQILHSQSVLFVGLQEHVIKVPLKRCLFYKTFSACIG
SQDPYCGWDMVMKKCTTLEESLSMSQWEQSITVCPTRNLTVDGHFGTWSQWKPCSHTDGA
STGSCLCRTRVCDSPAPQCGGWLCEGPTMEIANCSRNGGWTPWTSWSPCSTTCGIGFQVR
QRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHVFWTSWGPWERCTAQCGGGIQARRR
TCENGPDCPGCSVEYQPCNTNACPELKKTTPWTPWTPVNISDNGGHYEQRFRYTCKARLP
DPNLLEVGRQRIEMRYCSSDGTSGCSTDVGLSGDFLRSGRYSAHTINGAWSPWSAWSQCS
RDCSRGIRNRKRVCSNPEPKYGGLPCLGPSLEYQECNILPCPVDGGWSCWSSWSKCSATC
GGGHYMRTRSCTNPAPAYGGDICLGLHTEEALCNTQPCPDSWSEWSEWSECDSSGMQLRV
RQCILLFPVGSQCTGNTTESRACAFDSNFIPEISVARSSSREEKRCGVFYLFHILH
Download sequence
Identical sequences ENSGALP00000021271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]