SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000021981 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000021981
Domain Number 1 Region: 877-1057
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.86e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0038
Further Details:      
 
Domain Number 2 Region: 1032-1151
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.42e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 
Domain Number 3 Region: 171-194,231-381
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-28
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 4 Region: 12-158
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-18
Family Phosphotyrosine-binding domain (PTB) 0.034
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000021981
Domain Number - Region: 1168-1258
Classification Level Classification E-value
Superfamily Tropomyosin 0.0654
Family Tropomyosin 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000021981   Gene: ENSGALG00000013521   Transcript: ENSGALT00000022020
Sequence length 1270
Comment pep:known_by_projection chromosome:Galgal4:4:69306051:69395624:-1 gene:ENSGALG00000013521 transcript:ENSGALT00000022020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFKAKKYQAPSDFSASFTLQLVGSLPVHSLTTMSMLPWIVAEIRALSNTKSSKEEI
GISQIRLYISPSSLRCEPDTGKIQQWDPLICSGLFEYKPQHVHKLIHNSHDPSYFACLIK
DGAANQQSICYVFKADDQTKVPEIISSIRQAGKIARQEEFQNNLSDIEDPFAKKFEVLFC
GRVTVAHKNAPPALIDECIEKFNHASCTKKSDSDSSSQQHPLMGEEEEKRPIRKSFSQPG
LRSLAFKKDFQEGSHRSNSFVRSFEEDAISLNLKSQLIYGHSVVQPTDIAENRTMLFTIG
QSEVYLISPDTKKVAIEKSFKEISFCSQGIRHVDHFGFICRESSENGGFHFVCYVFQCTD
EALVDEIMMTLKQAFTVAAVQQTSKAQPQLCETCPLQSLHKLCEKIEGLHPSKTKLELQK
HLTTLNSQEQASVFEEVKKLRPRNDQKENELIISILRNMYEEKQKNHVHIGEAKQTSQPS
AENAVNEVPSSAPRFRLDMLKNKAKRSLTESFESILSRGSKARGPLDSSSGSVDLEASVS
SNLSSTNKEQPLSERETDRVPTLPPENAVKSSGSVDDLSSDPDSYAIDHSVTLPQQSFRR
RANTLSHLPSESRESLVPVETSPSVPQRKLMRYHSVSTETPHKRNNVQQFLPLIEPKSSS
GQLARSPTLARLNPSASSPNFFKYLRHNSSGEQSGHFAQKSISYRTALRKKLHSSSSVPN
FLKFLAPVDENNTSDFRSTTSDYESKHSQQAAGADSPVRTRRHSWRQQIFLRVATPQKAC
DSPSRYDDYTELGELPPSPLEPVCEDGPFGPVKEERKRTSRELRELWKKAIIQQILLLRM
EKENQKLQASENNLQNRRLKLDYEEITPCLKEVTLIWEKMLSTPGRSKIKFDMEKIHSAV
GQGVPRHHRGEIWKFLAEQYHLKHQFPNKQQPKDTPYKELLKQLTSQQHAILIDLGRTFP
THPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGVLLLHMSEEDAFKMLKFLM
FDVGLRKQYRPDMTILQIQMYQLSRLLHDYHRDLYNHLEEHEIGPSLYAAPWFLTMFASQ
FPLGFVARVFDMLFLQGSEAIFKVALSLLGSHKPLILQHENLETIVDFIKNTLPNLGLVQ
MEKTISQVFEMDIAKQLQAYEVEYHVLQDELIDSSLNDNQRLDKLEKANSSLRKQNFELL
EELQVANGKIQNLEATVELLLTNEGKLKESILTLEQERTALQKAVEEMRRKIGDTNEKPL
LTRQEHLDAD
Download sequence
Identical sequences ENSGALP00000021981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]