SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000023008 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000023008
Domain Number 1 Region: 788-1081
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 9.25e-81
Family Complement components 0.0000506
Further Details:      
 
Domain Number 2 Region: 1162-1288
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 2.22e-37
Family Alpha-macroglobulin receptor domain 0.0000573
Further Details:      
 
Domain Number 3 Region: 634-737
Classification Level Classification E-value
Superfamily E set domains 8.54e-28
Family SVA-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000023008   Gene: ENSGALG00000014252   Transcript: ENSGALT00000023051
Sequence length 1330
Comment pep:novel chromosome:Galgal4:1:75569495:75630018:1 gene:ENSGALG00000014252 transcript:ENSGALT00000023051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKPSTFECISFKSEEVVFLHVLIRSSDSVLFEGYKKVLVKPQESIILIETDKAFYKPGE
TVKFRIVSLDDDLMVIKKEYLQIWLQDPEYNRIAEWLNVKSRHGIVDLSFPLASEAALGK
YIISVQDMAQKTFSVKEYELIKFELKFEHPPFISTEDEEFQLKLCGKYTYGKPVQGKIDI
TFITLLQWGSNRVKTKALELNESDSCIIVIGEMEEIGTGSLCPESLVLSFPKPQIFFSLQ
TGAQTKDFSRISIVTRMKSIEFINLHPFYKRGLPYTGQLKALQVEGFRKTNDRKKNNNVL
EVAQHNWQLRWYGTVSSSCHVILIAYSHFCTLKGTYFLENGTKDNYGQNAGIEKSFHWLK
PFYSESNSFLEIKARNDVMPCDQEQKVQNSGPSMALLFSLQVIAKGRILFSDLHGSFSLT
LTIGNDFLPDIKLLVYTVFLDGQVVADVEEFQVAKCFRHKVELDFSSKQEVPGSKVSLNL
KAAPGSLCSVQSVDKSVLLMENNTLTADTYFIYQQLPYETCYDISRFCLITVFQSLRMKI
LTNTKIKKPVSCMQQNFERKMLPNKNSVMGKSDDTKKPKARTYFPETWIWDLVPISDEGQ
ASLQVTVPDTITEWNANTFCVADTGFGLSHLATLRVFQPFFVDLSLPYSVIQGEIFSLKA
TIFNYLKDCIQVHTTLIETPELKVDACPGCQFTSCLCANEAKIFAWNVTATRLGEVKVAV
TPLQGKMDTVIKPLLVKPGGILQEKTQNAFLCATDNTVSEEFSLTLPAETLEGSGRATFS
VIGDIMGPALQNLDQLLQMPFGCGEQNMVQFAPNIFVLQYLKKTKQLDPEIEVIALYFLR
TGYQRQLLYKHDDGSYSAFGKSDTQGNTWLTAFVARSFGQASSYIYINKDHVQDAVLWLQ
KHQLSNGCFQSVGKLFNNDLKGGVDDTISLTAYVAAALLELQLEKNDTMLDNALRCLKNV
TFDETSLYVKALMAYVFTLTEDVEMRQELLDKLEKETVFFLYASAEHLTSDSSSEESSSM
IEIVAYILLAHVSKPDFAVNDSAVSKLVHWLSKQRNALGGFASTQDTVVSLQALAQYAAL
IPHEVRDVKVTVKGKEASPLEFHVHKNNKLVLHQASLLEVPGMYTVEATGSGCVYIQLLV
ISLLKAGGINRPLAHAEKFDVETVTRECDGVRKQFDIHISVSYTGDRETSNMALVEVDML
SGFIPTKRSVKELENVFLVKKAEIKPDKVTVYLEELDKTSLNLNISVEQDNEVQILKPAT
VHVYDYYKPDDRTAREYNSPCSSEYSSCTMPYVFSFCRCLDERFRQEHHGSGTSNLLCSE
LSAIFPRIWL
Download sequence
Identical sequences ENSGALP00000023008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]