SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000023128 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000023128
Domain Number 1 Region: 1127-1303
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.22e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00051
Further Details:      
 
Domain Number 2 Region: 689-804
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.92e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0019
Further Details:      
 
Domain Number 3 Region: 469-581
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-23
Family Pleckstrin-homology domain (PH domain) 0.000029
Further Details:      
 
Domain Number 4 Region: 897-1041
Classification Level Classification E-value
Superfamily PH domain-like 2.14e-18
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 5 Region: 1437-1549
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-16
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 
Domain Number 6 Region: 591-704
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000604
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 7 Region: 21-84
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000962
Family SAM (sterile alpha motif) domain 0.00032
Further Details:      
 
Domain Number 8 Region: 1018-1119
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000712
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000023128
Domain Number - Region: 1332-1417
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0155
Family Ras-binding domain, RBD 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000023128   Gene: ENSGALG00000014343   Transcript: ENSGALT00000023171
Sequence length 1700
Comment pep:known_by_projection chromosome:Galgal4:4:69799893:69923066:1 gene:ENSGALG00000014343 transcript:ENSGALT00000023171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVRANIRNEAAIMSSTGSDIDIEEFLVNINLGQYLPNFKEHGYNVVTDCVGINNSALQQ
MGVLPTGHRRRILKQLDTALSKMQGNSLPHDNLKLKVLKGLEKKQYSFSDEDSPVSHLNV
DESGLIPATSLVQLPNKAYIGKERSRLGEQYLLEANDESFTNSDFPSLYRGSDSVLKTVS
GSMKMNTESNTLLEKAAAYQTDEHLADCVAFCDPLSLTHSYETKYKENKHQMFAVEEDLC
DSEPHSPFVKFKGEMIDNDLYDSCTQNCVKVFPRTSRSFILRHRPVPEIPESSKVDTSSS
SLQKRRNVDLIDVSCAGRQVSQKKTSSEEKPPVISPYGETYFWDNLKDAKELHRNEFLAC
ENKSDLEMPEEYSSNKNICSLNNQDEKTKECVKNESLSQENKSLPPEDFESEPVYSIVDQ
CSFSSKKNKNKTQTHSSSCSKNQSGKSNWLVSEQMDSQQFDGGQTSIANESIAPYACFYG
SSVKKVKAGWLDKLSPQGKRMFQKRWVKFDGDSISYYNNEKEVFSKGIILLSAIATVRVH
GENKFEVVTSHRTFVFRVDKEEERNDWVNKILNAVKSQSDNNPQSRISVAPEKSGYLELK
GYKAKIFILLQGNTVWICKNEQDFKTGFGITLIPMNVANVKQVDRAAKPSFEIITPYKSF
SFTAESEREKQDWIEALQQSIAETLSDYEVAEKIWFNESNRSCADCKAPNPDWASINLCV
VICKKCAGQHRSLGPRDSKVRSLKMDASIWSNELIELFIIIGNKRANSFWAGNLPPDEEL
HMDAPAEKRIAFITQKYKEGKFRKTPFPYKTKEQLNKALCAAVVKQDVLETLMLLFSGAD
VMCATGDPVYSTPYLLAKKAGQRLQMEFLYHNKFSDFPNYDTSFESGFSEDSSHSTFLCE
FLYKVSSNSTKLLTEKKLKEDCNKRWCTLESGFLSYYENDKATTPNGMLDINEVICLVVH
NSEYFLNRGDIFTFEIYLMSERVFLFGAETAYSQRKWTWAIAKHFVPPVAECLLERDCDL
IGQLYYKDCHNLDQWRKGWFAIEKSSLHFCLEMENAQEDSIYLRRLQELTISSVMQNGEK
IDVLLLVEKGRTLYIHGHTKLDFIVWYTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIA
FVTQYGLGSKHIYLKNGNSSNVAELLESFKKDARSVKLRAGKHQLEDVTDVLKSFLSQID
DAILTKELYPFWISALDMQNEKERVMKYGAFIRTLPPVNKATLAALIEHLYRVQKCSEIN
HMNPHNLALVFSSCLFQTKGQTSEEVSVIEDLIKNYVQLFDVNEDQVKQMDIENSFITRW
KDTQVSQAGDLLIEVYVERKEPDCSIIIRVSPLTEAEELTNDILGIKNITPNKDDIWATF
EVLENGELERPLHYTENVLEQVLHWSSLPEPGTAYLIIKRFLTADMMKLYNERNVKGSVK
AGYLKYKEEPSKLLSGNKFQERYFVLREGNLLLYKDMKASKPEKVLPVNSLKLYLGVKKK
MKPPTNWGIVAISEKHQWHICCDGQEAQIDWMISIFTAKHANIWPPAGKARKQSITKSPK
IGGLQLIPIQQEKNTCKIRGSTEDIQLRLGKPKCDEHNEVDLVEERKNLKEKASIVAQCL
ERKEEKVQNHAKTHRSFVSVEDMGVGMADLRQRSHKPPKKAKNKTNKTTLELDNKLPSNV
IQELNTVLQKNRILHDETSS
Download sequence
Identical sequences ENSGALP00000023128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]