SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000023934 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000023934
Domain Number 1 Region: 264-533
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-82
Family Protein kinases, catalytic subunit 0.000000000324
Further Details:      
 
Domain Number 2 Region: 151-295
Classification Level Classification E-value
Superfamily SH2 domain 2.42e-40
Family SH2 domain 0.00000613
Further Details:      
 
Domain Number 3 Region: 77-202
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-28
Family SH3-domain 0.0000624
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000023934   Gene: ENSGALG00000014860   Transcript: ENSGALT00000023980
Sequence length 541
Comment pep:known chromosome:Galgal4:2:101577601:101591372:1 gene:ENSGALG00000014860 transcript:ENSGALT00000023980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCIKSKEDKGPAMKYRTDNTPEPISSHVSHYGSDSSQATQSPAIKGSAVNFNSHSMTPF
GGPSGMTPFGGASSSFSAVPSPYPSTLTGGVTVFVALYDYEARTTDDLSFKKGERFQIIN
NTEGDWWEARSIATGKTGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIF
LVRESETTKGAYSLSIRDWDEVRGDNVKHYKIRKLDNGGYYITTRAQFESLQKLVKHYRE
HADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTKV
AIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMTKGSLLDFLKE
GEGKFLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGDNLVCKIADFGLARLIE
DNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREVL
EQVERGYRMPCPQGCPESLHELMKLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGDN
L
Download sequence
Identical sequences G1NBR9 P09324
ENSMGAP00000010110 NP_990632.1.86415 XP_015710822.1.68032 ENSMGAP00000010110 ENSGALP00000023934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]