SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000024599 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000024599
Domain Number 1 Region: 267-459
Classification Level Classification E-value
Superfamily Nudix 8.26e-46
Family NADH pyrophosphatase 0.0012
Further Details:      
 
Domain Number 2 Region: 14-100
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.61e-19
Family Ankyrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000024599   Gene: ENSGALG00000015268   Transcript: ENSGALT00000024645
Sequence length 465
Comment pep:known_by_projection chromosome:Galgal4:Z:49683389:49694048:1 gene:ENSGALG00000015268 transcript:ENSGALT00000024645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNFEKNFHQEMVSQLHNFAAVGDAARLKALLSRSPSLINATAGNGWTALMYAARNGHFD
VVRILLEGGCDRSIINKSRQTALDIAKFWGYKHIANLLANAKGGQKPGFLPTEVKEYSNY
FGTTLLDRRSDKRIDSKWLSKKQSHPATVYILFSDLSPLVTLSGGAEKSQQPEVRLCRLH
HKDVEQYMIQTEEFTLIFLGVDLQFHMNLTVAAHNGKVLQEDDEDGLVAWFALSINPTSA
ERFKQKHEDCYFLHPPMPALLQLPENEAGVVAQARSILAWHSRYRFCPTCGSATKIEEGG
YKKTCVKEDCPSLQGVHNTSYPRVDPVVIMQVIHPDGNHCLLGRQKRFPPGMFTCLAGFV
EPGETIEDAVRREVEEEAGVKVGHVQYVSCQPWPMPSSLMIGCLAVAVSTEIRVDKNEIE
DARWFTREQVVDVLIKGNQRSFFVPPSRAIAHQLIKHWIGMNANL
Download sequence
Identical sequences E1C2E5
ENSGALP00000024599 XP_001231287.1.86415 XP_004949354.1.86415 XP_015135943.1.86415 ENSGALP00000024599 9031.ENSGALP00000024599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]