SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000025144 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000025144
Domain Number 1 Region: 2537-2649
Classification Level Classification E-value
Superfamily C-type lectin-like 6.3e-27
Family C-type lectin domain 0.00014
Further Details:      
 
Domain Number 2 Region: 2494-2536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000529
Family EGF-type module 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000025144   Gene: ENSGALG00000015624   Transcript: ENSGALT00000025190
Sequence length 2649
Comment pep:known chromosome:Galgal4:Z:62474981:62580840:-1 gene:ENSGALG00000015624 transcript:ENSGALT00000025190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTIDAKVLYITTVVPASVTAGSEGRFGSEKFTHTPPVSGMWLQTDKDQVYMTEETSHTK
RIELDTEDDISGMEPTSSPGQIIEYTKHLGAPVSAVTDETKTSMETAETESDEEVVSADF
DQTKGTTEVFHTSSSLDLEKFTLSKIPEDESSATVKSFSSSSGTVLPTAVATVLEVTDHE
ADETSGYVLNMTFSTPEGEQRKATEKSPATSAEDEVSTGTEISKYTMTEGGQISSVTSAE
KESVAALQEREEQPSVGLPETKEPFKFTDVTEIETTVPQREGDTSLVPVTVGSEDIGEMQ
VTDHTSFDSIIHTEATVTSTKASEVFPKELSTKDQDRELGTAMGSTLPVTSVQMHEQKTT
AGFESPQTTTQEKHDEMGSAYDEMYPATELSVPALMLTEYGQVSGPVETSTRSSHLTGTP
KAETATDQEEKITEAVPVTFGTQAKVYESKGTTTREEDRDVGSWNSVLPPHTMLSSPSTA
GSISLLTLGASPSQTPEGSGISEELEEVKTVPFSSRATDKTTVISDLTTSSISAVDKIQP
TSASKPFVSSKSPRIIPEEDEEVTSSDIIVIDESISPSKASAEDDLTGKMVEPEIDKEYF
TSSTATAVARPTAPPTVMEATEALQPQEVSPTSHPDSGTDIRLYVIQITGNDTDHPVNEF
LDLFSRHILPHAVDETHTDAESAQTEPCTSDSVQDSSEYIILDPFFPNFMDFEEEEEDCE
NTTDVTTPPALQFINGKQQVTSAPKSTKAEEARSDQIESVAHSKNVTFSQINETNTFIIS
ETEASGTMQPSKAGEVMGAFEVTQPTADVAMLEPVYSGESEVTTTDKYLEITSVYEQSPQ
KNKETVMWHGTEESSTKDTKNLLLITNESSGDGSTESDLSRSVFTEILTMSSHEDSEKIS
HTTSVPTILSVERSAVTAAPSADSDTATVGIDVKDLIPKGGTATPGNYYKSTIKLDAEFP
FESNPEATSHTTKPDMTASSFIVLEGSGDVEENSTLASAMTTETAVAETLSVQDTSLGSG
TVLPTEISVTISEITPALPGGTRILYSTFDQSSEATVSTNFVSELIMEQVVGSSVATEKK
VEDEKEVQTTVYSSQEISTTDAKGKSELDEFGSTTNEVRTVSQEPTPLREIVPITGTMHS
EIKKVTATPFLREKLFINEGSAEEPADLFAGSPTRKVVSTDSPFTDSGSGDIDVITESAT
LTSVPSRSVIETQTVKHEGNINVISVSLKNTTTEYEEHIGTGGPVTSVSSTGSDGLTEES
EVAIEMSENVFSTENQGEPTQEAVPTYTAPSDIKSRLGSRREVTSHVTPVIRTKDLETAE
VTSSPESVVNNSTLDTMVTHGTIRAVAESTESKKGKGSFSAVSLGKILMIEHGSGEELKV
DSSTTKLMSNGPTEKLLGSHFSFFDQGSGEAETLTESFTKASVSPTGKPEPQEQYGRKTV
SMPSAVVHAYTAEPNELVTSTEHDITSLQTVTDTEMEEKAANELTVTSFATNLPLSEDVH
SWEDRPREILPKAIESSGEATEDPFFISTQANHEHVEFLSVPTIRPHSEENKVEAESDEK
ILLPFNNDRVTESAVIERKYLSSPVTDTEQEEELVQNIFPTEDIPRLFLTPKEEKPTNNE
LISDPLFSGQGSGDEFTVIPSVESLAVKETTNTLSPWPFHPASVGPQLSTDKTQVFESGS
TDSNAEINEEITTTAAELLTETAYSMATSSPALEEESSSHSNSKDKDITHYFLVIEDPYN
KEMDHRRGENGTSRPLPTPGDVSLEESSHMLTTDDVTPVSVILSETPYLEMGKSLATSAT
KMPSRVLPESSGEGSGWDGVSDSFAPDTLTHSTAPSVMEVELTASSHIPGVYSEVMTTHV
PGDGSQTVITGLASLFTEEKEIVANQTAADPKTGTSEELTSDTGMSLDIIPVVDDRRHVT
LNVSVYGDITLIEERLQIPSEKTTIIDMDHSKSMPEDIISVQTMPNLVIRSTQVSDDNMK
AEEDKYDSILNFSTVEENSFGSGDNLSLTTSIQPSSESVTAGHGPKLVDKDLGSGYAMQF
ATETLTTTVLNELGIFLPTVPSLVSPHMPHESKESEFEAKHIGRTSTTDDVYEPYTSANN
QVITDQSKTMSISGFSGMGQEESGDKKPMIPSLTPDLTMETEKALTTDTFDVSMVTTQSM
SQHATVSSSSSEEKHSTVYMQTKSASTEYEETDSVSLNSVSQNPKSSVTVWLVNGVSKYP
EVIIPSTSSAKDSDQSDHSSDGTFKEVSSDMAATYKPPTTDLDTTVSSLLVFSPEPESES
ISTESTPHFNKFVTERSEETESSVNDLIIEENATVSGDSPSIHDYPTAFWNFGERTSTDV
PKLSTIEVEFSSERVKNPSQESDRSTERERPRLSSAPVSDSPNSIEVGVFKPDQEAVTML
TSSLEPLDRSLETQSALLGQQEITTISSNIATNNTAPGNNPYSNEQSTISSELLNTIELV
TSSFSLPEVTNGSDFLIGTSVGSVEGTAVQIPGQDPCKSNPCLNGGTCYPRGSFYICTCL
PGFNGEQCELDIDECQSNPCRNGATCIDGLNTFTCLCLPSYIGALCEQDTETCDYGWHKF
QGQCYKYFAHRRTWDTAERECRLQGAHLTSILSHEEQVFVNRIGHDYQWIGLNDKMFERD
FRWTDGSPL
Download sequence
Identical sequences ENSGALP00000025144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]