SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000025216 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000025216
Domain Number 1 Region: 5-129
Classification Level Classification E-value
Superfamily PH domain-like 1.86e-22
Family Pleckstrin-homology domain (PH domain) 0.004
Further Details:      
 
Domain Number 2 Region: 458-533
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000104
Family SH2 domain 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000025216
Domain Number - Region: 204-209
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0654
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000025216   Gene: ENSGALG00000015665   Transcript: ENSGALT00000025262
Sequence length 539
Comment pep:known chromosome:Galgal4:4:81924388:81959922:-1 gene:ENSGALG00000015665 transcript:ENSGALT00000025262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEEQVWPVPMKAIGAQNLLTMPGGVTKSGYLHKKGGTQLQILKWPLRFVIIHEGCIYY
FKTSTSASPQGAFSLNGYNRVMRAAEETTSSNVFPFKLVHISKKHRTWFFSASSEDERKN
WMLSLRREIDHYHDKKETVTEFSDSGSDADSFYGSVERPIDIKYSHHSADNEDYDQEEDD
ESYLQPDTSDIVKDDFMVLPPAYPPPPVPHVRKAAYSESRSHSFSGKTAGSTPPPPPPKR
SLPEIKTEDFFGVREPQLPCRAEPNLKIQSSSRRPSEQPPPVPPLPLFKKPFCVKEPSSL
PPELPLSHVLTTTEGCEKLKTLNLSPRTPPPLPSNKPKLSQITEKTVENKVPREHGKPGL
FVPPVLPKPPVPGHQHSVLKPRPEKPSCPQLQRSPPDGQSFRSFSFEKPALPSKPNQVND
DSDDDYEKVELPTSIFLNTSESLEVERIFKATSPKGQPQNGLYCIRNSSTKAGKVLVVWD
QSAEKVRNYRIFEKDCKFYLDADIMFLNMGSLVEYYSTHVLPSHGSLILRCPYGYSKPR
Download sequence
Identical sequences F1ND54
ENSGALP00000025216 XP_015141275.1.86415 XP_015141277.1.86415 ENSGALP00000025216 9031.ENSGALP00000025216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]