SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000026726 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000026726
Domain Number 1 Region: 502-804
Classification Level Classification E-value
Superfamily L domain-like 4.08e-46
Family Ngr ectodomain-like 0.0082
Further Details:      
 
Domain Number 2 Region: 894-1049
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.83e-36
Family Toll/Interleukin receptor TIR domain 0.0000505
Further Details:      
 
Domain Number 3 Region: 52-340,400-438
Classification Level Classification E-value
Superfamily L domain-like 1.05e-35
Family Ngr ectodomain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000026726   Gene: ENSGALG00000016590   Transcript: ENSGALT00000026777
Sequence length 1059
Comment pep:known chromosome:Galgal4:1:122856250:122862991:-1 gene:ENSGALG00000016590 transcript:ENSGALT00000026777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNLSEVAAHRKMVHHARTSNALLFVLLFLFPMLLSGRWFPKTLPCDVEAFESTVRVDCS
DRRLKEVPRGIPGNATNLTLTINHIPRISPASFTQLENLVEIDFRCNCVPPRLGPKDNVC
VTPPSIENGSFAALTRLKSLYLDANQLSKIPRGLPATLRLLSLEANNIFSIKKNTFSELR
NIELLYLGQNCYYRNPCNVSFEIEETAFLNLKNLTVLSLKSNNLTFIPPNLSSTLKELYI
YNNRIQEVQEHDLSNLYNLEILDLSGNCPRCYNAPYPCTPCPNISIKIHSKAFYSLKKLR
ILRLHSNSLQSIPSSWFKNIKNLKNLDLSQNFLIKEIGDAEFLKLIPSLVELDLSFNFEL
QMYSPFLNLSKTFSCLSNLETLRIKGYVFKELREENLDPLLNLRNLTVLDLGTNFIKIAD
LRVFKKFRSLKIIDLSMNKISPSSGEGNFYGFCSDHRITVEQYSRHVLQEMHYFRYDEYG
RSCKSKDKEADSYQPLVNGDCMSYGETLDLSRNNIFFVNSIDFQDLSFLKCLNLSGNAIS
QTLNGSEFYYLSGLKYLDFSNNRIDLLYSTAFKELKFLEILDLSNNKHYFLAEGVSHVLS
FMKNLAYLKKLMMNENEISTSISTGMESQSLQTLEFRGNRLDIFWSDGKKEYLSFFKNLT
NLEQLDISSNMLNFLPPDVFEAMPPELKILNLTSNRLHTFNWGKLHLLTKLITLDLSNNL
LTTVPRKLSNCTSTLQELILRNNRITRITKYFLRGAIQLTYLDLSSNKIQIIKKSSFPEN
IINNLRMLLLHNNPFKCNCDAVWFVGWINQTQVAIPLLATDVTCAGPGAHKGRSLVFLDL
NTCELDTSYFIMYALSTSAVLCLMMFAVMSHLYFWDVWYSYHYCTAKLKGYRRIPLPDAC
YDAFIAYDNTDLAVNEWVMTELVEKLEDQKARQFNLCLEERDWLPGQPVFDNLSQSIQLS
KKTIFVLTNKYIKSGTFKTTFYMAHQRLLDEKIDVIILIFLEKVLQKSRYVQLRKRLCRS
SVLEWPTNPRSQPYFWQRLKNAIAMNNTLSYNKLLQETV
Download sequence
Identical sequences C4PCM1 C4PCN9
9031.ENSGALP00000026726 ENSGALP00000026726 ENSGALP00000026726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]