SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000027374 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000027374
Domain Number 1 Region: 4-118
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 4.18e-38
Family Rap30/74 interaction domains 0.000000956
Further Details:      
 
Domain Number 2 Region: 175-242
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.07e-25
Family DNA-binding domain from rap30 0.0000398
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000027374   Gene: ENSGALG00000016974   Transcript: ENSGALT00000027426
Sequence length 249
Comment pep:known_by_projection chromosome:Galgal4:1:166965970:167057679:1 gene:ENSGALG00000016974 transcript:ENSGALT00000027426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEKGELDLTGVKQNTGMWLVKVPKYLSQQWSKASGRGEVGKLRIAKNQGRTEVSFTLNE
ELASISDIGGKPAAVSAPREHPFLLQNVGGQTLTVFTESSTDKLSLEGIVVQRAECRPAA
SENYMKLKRFQIEESSKPVRLSQQLDKAVTTNYKPVANHQYNIEYEKKKKEDGKRARADK
QQVLDMLFSAFEKHQYYNIKDLVDITKQPVIYLKEILREIGIYNVKGTHKNTWELKPEYR
HYQVEDKSD
Download sequence
Identical sequences ENSGALP00000027374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]