SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000027464 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000027464
Domain Number 1 Region: 197-364
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.62e-41
Family Dual specificity phosphatase-like 0.00000928
Further Details:      
 
Domain Number 2 Region: 375-510
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.04e-36
Family PLC-like (P variant) 0.0022
Further Details:      
 
Domain Number 3 Region: 56-192
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000408
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000027464   Gene: ENSGALG00000017031   Transcript: ENSGALT00000027516
Sequence length 511
Comment pep:novel chromosome:Galgal4:1:169788267:169803952:1 gene:ENSGALG00000017031 transcript:ENSGALT00000027516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTVRYEQGSELTETSSSPTADEPTIKIDDGRDEGNEQDSCSNTIRRKISPFVMSFGFRV
FGVVLIIVDIIVVIVDLAISEKKRGIREILEGVSLAIALFFLVDVLMRVFVEGFKNYFRS
KLNTLDAVIVVGTLLINMTYSFSDLAATDQMPRMVTLLRVLRIVILIRIFRLASQKKQLE
VVTRRMVSENKRRYMKDGFDLDLTYVTDRVIAMSFPSSGKQSFYRNPIEEVARFLDTKHA
DHYKVYNLCSEKGYDPKYFHYRVERIFIDDHNVPALQDMLKFTASVREWMNQDEKNIIAI
HCKGGKGRTGTMVCTWLIHSDQFESAKESLDYFGERRTDRTMSTKFQGVETPSQSRYVGY
YEILKNKYNFQLPPERQLKIKNLKIHSIHGVGKGNGTDMKVQIIMKKQVVLECVCATQGN
CKLFFDSESDSVVIGLEDSPVISGDVKVRFESNSDLPKGYDDCPFFFWFNTSFIENNRLY
LPRNELDNPHKSKTWKVYSEAFAVEMNFTEL
Download sequence
Identical sequences E1BUX1
ENSGALP00000027464 9031.ENSGALP00000027464 ENSGALP00000027464 XP_004938790.1.86415 XP_004938791.1.86415 XP_004938792.1.86415 XP_004938793.1.86415 XP_004938794.1.86415 XP_015131439.1.86415 XP_015131444.1.86415 XP_015131446.1.86415 XP_015131450.1.86415 XP_417079.2.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]