SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000030293 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000030293
Domain Number 1 Region: 601-734
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-41
Family C-type lectin domain 0.00022
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000030293
Domain Number - Region: 278-367
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.000155
Family Fibrinogen coiled-coil and central regions 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000030293   Gene: ENSGALG00000014910   Transcript: ENSGALT00000030930
Sequence length 742
Comment pep:known chromosome:Galgal4:2:101677428:101769743:1 gene:ENSGALG00000014910 transcript:ENSGALT00000030930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDDFAEEEEVQSFGYKRFGIQEGTQCTKCKNNWALKFSIILLYILCVLLTITIAILGYK
VVEKMDNVTGGLETSHRRYTEKLTEVESDLKKLDDQAGQKALNTNTELSSFRSDILALRQ
QLHDIAEKTTRNKDTLEKLQESGNVLDDRQSQMRSALDSNSFMIISVNKTLQAYTGYINN
LQQDTSNIQSDLQNQVHSHNVVIMNLNNLNLTQIQQRNLISVLQKSMEDKSLAILRIKND
FQNLQQVVLQARKDTDWLKEKVQNLQTLAANNSALAKANNDTLEDMNNQLSSFSGQMENI
STIAQANEQNLKDLQEQHKEYENRTSAKFNQLEERFQVFETDIVNIISNISYTAHHLRTL
TSNLNEVRTTCTDTLSKHSDELIFMNSTLANIRLDSASLKMQQDLMRSRLDVEVANLSVI
MEEMKLVDSKHGQLIKNFTILQGPPGPRGPKGDRGPQGPLGPAGLKGQKGEKGEPGPPGP
AGEKGPPGPIGPPGEKGGKGSRGSPGSKGQRGSPGKTGLPGPSGDPGPPGPQGKDGPQGP
QGPPGFQGLQGTVGEPGVPGPRGLPGLPGVPGLPGPKGPPGPPGPPGPGMPMALQSEPTS
VPEANGCSPHWKNYTEKCYYFSIEREIFEEAKLFCEEKASRLVIINNKEEQQWIKRQISG
KGSFWIGLTDSEKENEWRWLDGSLPLYTNWKTGQPDNWNHGHGPGEDCAGLIYAGLWNDF
YCEDVNNFICEKDMDKEQIFGV
Download sequence
Identical sequences F1NIN5
ENSGALP00000030293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]