SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000035830 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000035830
Domain Number 1 Region: 494-796
Classification Level Classification E-value
Superfamily L domain-like 4.08e-46
Family Ngr ectodomain-like 0.0082
Further Details:      
 
Domain Number 2 Region: 34-437
Classification Level Classification E-value
Superfamily L domain-like 3.74e-39
Family Ngr ectodomain-like 0.067
Further Details:      
 
Domain Number 3 Region: 886-1041
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.7e-36
Family Toll/Interleukin receptor TIR domain 0.0000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000035830   Gene: ENSGALG00000016590   Transcript: ENSGALT00000036619
Sequence length 1051
Comment pep:known chromosome:Galgal4:1:122856364:122862844:-1 gene:ENSGALG00000016590 transcript:ENSGALT00000036619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVWVHHARTSNALLFVLLFLFPMLLSGRWFPKTLPCDVEAFESTVRVDCSDRRLKEVP
RGIPGNATNLTLTINHIPRISPASFTQLENLVEIDFRCNCVPPRLGPKDNVCVTPPSIEN
GSFAALTRLKSLYLDANQLSKIPRGLPATLRLLSLEANNIFSIKKNTFSELRNIELLYLG
QNCYYRNPCNVSFEIEETAFLNLKNLTVLSLKSNNLTFIPPNLSSTLKELYIYNNRIQEV
QEHDLSNLYNLEILDLSGNCPRCYNAPYPCTPCPNISIKIHSKAFYSLKKLRILRLHSNS
LQSIPSSWFKNIKNLKNLDLSQNFLIKEIGDAEFLKLIPSLVELDLSFNFELQMYSPFLN
LSKTFSCLSNLETLRIKGYVFKELREENLDPLLNLRNLTVLDLGTNFIKIADLRVFKKFR
SLKIIDLSMNKISPSSGEGNFYGFCSDHRITVEQYSRHVLQEMHYFRYDEYGRSCKSKDK
EADSYQPLVNGDCMSYGETLDLSRNNIFFVNSIDFQDLSFLKCLNLSGNAISQTLNGSEF
YYLSGLKYLDFSNNRIDLLYSTAFKELKFLEILDLSNNKHYFLAEGVSHVLSFMKNLAYL
KKLMMNENEISTSISTGMESQSLQTLEFRGNRLDIFWSDGKKEYLSFFKNLTNLEQLDIS
SNMLNFLPPDVFEAMPPELKILNLTSNRLHTFNWGKLHLLTKLITLDLSNNLLTTVPRKL
SNCTSTLQELILRNNRITRITKYFLRGAIQLTYLDLSSNKIQIIKKSSFPENIINNLRML
LLHNNPFKCNCDAVWFVGWINQTQVAIPLLATDVTCAGPGAHKGRSLVFLDLNTCELDTS
YFIMYALSTSAVLCLMMFAVMSHLYFWDVWYSYHYCTAKLKGYRRIPLPDACYDAFIAYD
NTDLAVNEWVMTELVEKLEDQKARQFNLCLEERDWLPGQPVFDNLSQSIQLSKKTIFVLT
NKYIKSGTFKTTFYMAHQRLLDEKIDVIILIFLEKVLQKSRYVQLRKRLCRSSVLEWPTN
PRSQPYFWQRLKNAIAMNNTLSYNKLLQETV
Download sequence
Identical sequences F1NBN5
ENSGALP00000035830 XP_015129128.1.86415 XP_015129133.1.86415 XP_015129137.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]