SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000038625 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000038625
Domain Number 1 Region: 706-760
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000142
Family Laminin-type module 0.0000754
Further Details:      
 
Domain Number 2 Region: 602-653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000206
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 3 Region: 164-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000218
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 4 Region: 813-863
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000335
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 5 Region: 276-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000193
Family Laminin-type module 0.005
Further Details:      
 
Domain Number 6 Region: 762-810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000218
Family Laminin-type module 0.00052
Further Details:      
 
Domain Number 7 Region: 323-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000977
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 8 Region: 220-278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 9 Region: 651-708
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000921
Family Laminin-type module 0.00019
Further Details:      
 
Domain Number 10 Region: 861-906
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000322
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000038625
Domain Number - Region: 566-604
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00184
Family EGF-type module 0.057
Further Details:      
 
Domain Number - Region: 950-1036
Classification Level Classification E-value
Superfamily Tropomyosin 0.0249
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000038625   Gene: ENSGALG00000004620   Transcript: ENSGALT00000039414
Sequence length 1083
Comment pep:known_by_projection chromosome:Galgal4:8:7449296:7493463:1 gene:ENSGALG00000004620 transcript:ENSGALT00000039414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAGVQHPAAVNLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWVPYQYYSGSC
ESTYNKVNRGFIRTGEDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQE
WVTATDIRVSLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECIRNELGK
LVCNCKHNTFGDDCEKCLPFFNDRPWRRATAESANECLPCDCNGRSQECYFDPELYRSTG
HGGHCMGCRDNTDGAHCERCRDSFYRLGSEEGCLPCSCNPVGSLSTQCDSYGQCSCKPGV
MGEKCDRCQPGFHSLSEAGCRPCSCNPAGSTGECNMETGRCTCKDNVEGFHCERCKPGFF
HLDPSNPRGCTPCFCFGHSSVCTNAIGYSVYSITSSFQFGEDEWHAEQRDGSQVPLQWSS
ETQDISVISDSYFPIYFVAPRKFLGNQVLSYGQNLTFSFRVDRRDTRLSAEDLVLEGAGL
RVSVPLIAQGNSYPSESPLTYTFRLHEAADYPWRPALSAFDFQKLLHNLTAIKIRGTYSE
RSAGHLDDVTITSAVPGAGVPAAWVESCSCPAGYEGQFCERCSPGYRRETPGLGPYSPCV
PCTCNGHSETCDPETGMCDCRDNTAGSHCEKCSDGYYGDATAGTALDCQPCPCPGGSSCA
VVPRTKEVVCTSCQTGTTGKRCELCDDAYFGDPLGENGAVRPCRLCQCNDNIDPNAVGNC
NRQTGECLKCIYNTAGFYCDRCKDGFFGNPLATNPADKCRACHCNPYGTVNQQTSCNQVT
GQCECLSHVTERDCSACEPGFFNLQSGRGCERCDCHALGSTNGQCDIWTGQCECQPGVTG
QRCDRCEANHFGFGPEGCKPCDCDPEGSRALQCREDGRCECKEGFVGSRCDQCEENYFYN
RSWPGCQECPACYRLVKDKVAEQRERLRELENLIANLGTGEETITDQAFEERLKQAERDV
MELLREAQNSKDVDQGLMDRLRDINSTLTSQLSRLRNIQNTVQETENLAEQARGRVEDTE
DLIAMASDMLEKAKMAAGNVVSVLCRSMGRGEGRALPCWAVWLCFSAFSHCHSKFAVETS
SPY
Download sequence
Identical sequences ENSGALP00000038625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]