SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000039455 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000039455
Domain Number 1 Region: 59-165
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000722
Further Details:      
 
Domain Number 2 Region: 345-449
Classification Level Classification E-value
Superfamily SRCR-like 5.62e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000699
Further Details:      
 
Domain Number 3 Region: 189-293
Classification Level Classification E-value
Superfamily SRCR-like 3.79e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000986
Further Details:      
 
Domain Number 4 Region: 478-581
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000039455   Gene: ENSGALG00000001917   Transcript: ENSGALT00000040256
Sequence length 583
Comment pep:known_by_projection chromosome:Galgal4:19:4217392:4226022:1 gene:ENSGALG00000001917 transcript:ENSGALT00000040256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDECEIDVGWMQDEEPWGWQLSWGDGSLPKCGALPSSLLLLLFLLGPTGTSEPSPPPLP
ELRLANGPSRCQGRVEILYNGSWGTVCDDDWDIVDANVVCRQLGCGHAIAMPAPMTFGQG
SGPIFLDNVDCKGQEAALSECWSHGWGVHNCYHYEDVAVVCNELSPTSASEGPTSRTATA
SVQNGEGDGRIRLVSGADACQGRVEIFYQGSWGTVCDDDWGLSDASVVCKQVGCGPALAY
KSNAYFGYGMGHILLDNVNCEGSEPILSACYSLGWGIHNCGHHEDAGVICMGLDTSTVTS
FTTSTALDYEEMLTATATAVTDGHEQPSPATKVVTTVLVTAELESGGVRLANGNGSCRGR
VEVRHGGTWGTVCDDDWDFPDAQVVCRQLGCGPAVSATVLGSFGYGSGPVLLDNVGCDGH
EARLADCFHLGWGQHNCGHHEDAGVVCRGAGVEKRGSPWPGLAGTSPFSSTPSQCPTAGF
LRLVNGSHRCEGRVEMFYLSQWGTVCDDAWDLRDAEVVCRQLGCGSAVAAWGEAHYGPGT
GYIFLDNLKCKGSEPALLRCSHIRWDVHNCDHSEDASAVCSLL
Download sequence
Identical sequences ENSGALP00000039455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]