SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000041026 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000041026
Domain Number 1 Region: 290-412
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.02e-30
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00055
Further Details:      
 
Domain Number 2 Region: 52-164
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-25
Family Spermadhesin, CUB domain 0.00059
Further Details:      
 
Domain Number 3 Region: 186-269
Classification Level Classification E-value
Superfamily LCCL domain 5.1e-21
Family LCCL domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000041026   Gene: ENSGALG00000029066   Transcript: ENSGALT00000044183
Sequence length 412
Comment pep:known chromosome:Galgal4:23:2208276:2216695:1 gene:ENSGALG00000029066 transcript:ENSGALT00000044183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHERIPPRLSSTIAGSIPSGSTVRSGGHQSEGLPQLGSSSALRTAAVREGDGCGHTVLTA
QSGTLSSRNYPGTYPNHTVCHWQLRAPPGTSLIVAFGDVDLESSERCAHSSLLLADPESG
AAYGPYCRNAVPAAPLLLTNSSAITVLFNSTSHRSGRGLLLSYASSQHPGTHFSQEHHFC
PHPIHPVRFSVYCPAGCKDIEGDIWGNTKEGYRDTSVLCKAAVHAGVVADEVGGQVTLTR
EKGITLYESAFANGLHSKRGSLSEKRLLFHKGPQLSPHLAACGDALEVAAFNASSWWQEV
DALGQERSWAAERAALGTPSPSWAAEPGTDTAWLELDLGTRRNVTGIVTKGSAEIYDFYV
TSYRVSSSRDGKNWRPYRGGSGQEDKVFEGNVDSLGEVSNAFIPPITTRYLR
Download sequence
Identical sequences ENSGALP00000041026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]