SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000041083 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000041083
Domain Number 1 Region: 19-145
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-19
Family Phosphotyrosine-binding domain (PTB) 0.0085
Further Details:      
 
Domain Number 2 Region: 266-365
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000036
Family SH2 domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000041083   Gene: ENSGALG00000026828   Transcript: ENSGALT00000045194
Sequence length 376
Comment pep:known_by_projection chromosome:Galgal4:21:6741850:6746483:1 gene:ENSGALG00000026828 transcript:ENSGALT00000045194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKKMTANGRGPDPAPPPPRARGIAKSAEYVGSFMVEELELQQHVGQLEEQLRALKDCPR
RRSVVLRFSLQGLKVYGDDGETLLMAHALRRILYSTCLHAERQFAFVARNPHSPPSTLFC
HLFVSPVGEVHVLHLLLCRSFQLCYLQAHPELQAAEPDPPVLLRETLNPEEVSRNVNALL
SLRRLPALGPLGAGERRVEAEGRAVGWRPGNPYCSPVLVRKKAIRSKVLRSGAYRDCGAE
SQLQQREGAPSGWESRGMRGLVLLPDTEAALAESVWAFAGIARASGIALLRGDVPGAFLL
RPEPGATPRWCLWVRTPCGVVPYCVLRTQQGRFCVEHSHAEFRSMPALLAHYSAVPGGCF
CRLSVGRCNPGYEQRD
Download sequence
Identical sequences ENSGALP00000041083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]