SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000041309 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000041309
Domain Number 1 Region: 1163-1358
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.73e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000232
Further Details:      
 
Domain Number 2 Region: 949-1072
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-32
Family Pleckstrin-homology domain (PH domain) 0.00000113
Further Details:      
 
Domain Number 3 Region: 44-168
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-19
Family PDZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000041309   Gene: ENSGALG00000007721   Transcript: ENSGALT00000044603
Sequence length 1990
Comment pep:known chromosome:Galgal4:2:16733685:16817876:1 gene:ENSGALG00000007721 transcript:ENSGALT00000044603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQFKILDCVINHKWSFICNLYCAWSGQASKNKDGKEQSEAISPSEEEEAFSWPGPKTVV
LRRTSQGFGFTLRHFIVYPPESAVQFSFKDEENGNRQGKQRNRLEPMDTIFVKQVKEGGP
AFEAGLCTGDRIIKVNGESVIGKTYSQVIALIQNSDSMLELSVMPKDEDILQLAYSQDAY
LKGNEAYSGNAHNIPEPPPICYPRLTSTTSVVAQAGDKLSSDFSLGKQQVGRPVRALTQP
ERAYRMEIQVPPSPTDIAKSNTAVCVCNETVRTVIVPSEKAVDLPSCRNNHAGPSHRTEE
IRYGLKDQTTLKARTTSPSSSVSTAIVLPQTPLTRPGDPNGTVIKASNYVVCPEGIPSTR
PSVQATDSSSVSTNHYSSPSSHQHIDWKNYKTYKEYVDNRRMHMYGSRTIQERLDSLRAA
SQNTTDYNQVVPNRTASQVRRRSTSHDRVPQSAQIRQRSVSQERLEDSVLMKEWPRSASQ
DTLTSPSISARNHRARSWDYLSKQGEMLENFHSENLIADTNGDRRKTYKWTGFSEQDDRR
GIYERPRQHAFHMSLRGQNFPMAPSGYISDSRRVGSRASLPGSHFQKVPPDIRMLQTSRE
LQTPGGISKPTAVSQERSSLTTARSSKSSSLKNSSYAAKPSFPLNQSLDVLASKDQRTVN
HLHQSGLLNQQSRIRGEGAPDHRTETGKTVQPSSLSPTSAKLVQQTSESSATSDNTGVSI
RKKSHDFERENAHEPEILQTDVQGNDKDAVVMRDKSPSGHQTPQPLRHQSYILAVNDQEA
ASDTTCWLPNDARREVHIKRIEERKASGSTPPGDSLASIPFIDEPTSPSIDHDIAHIPAS
AVISASASQAPAITTVPPSPTSPIPLIRRQLSHDHESIRPSVLDSQPATKPERSKSYDEG
LDDYRDEEKSSIKHVSSLKGIKVTDSQKSSEDSGSRKDSSSEVFGDASKEGWLHFRQLVT
DKGKRVGGSIRPWKQLYVVLRGHSLYLYKDKKEQMTPSEEEQPISINACLIDISYCETKR
KNVFRLTTSDCEYLFQAEDRDNMLAWIKAIQENSNLNDEDTGVTSRDLISRRIKEYSTMM
SSSSSKTEPSPKTPRQSLSIRQTLLGTKADQRTQSPHSPKDESERKLLTKDETSPPKDKG
TWRKGIPSIMRKTFEKKPSAVGTFGVRLDDCPPAHTNKYIPLIVDICCKLVEERGLEYTG
IYRVPGNNAAISSMQEELNKGMTDIDVHDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYA
DFIDANRKEDPVERLKTLKRLIHDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIV
FGPTLVRTSDDNMTHMVTHMPDQYKIVETLIQKHDWFFTEDDAEEPLTAVQEENTVESQP
VPNIDHLLTNIGRTGVSPGDVSDSATSDSTKSKGSWGSGKDQYSKELLVSSIFAAASRKR
KKTKEKPQPSSSEDELDNVFSKKELAEQSRGDTAKEDTAKGEYEKERDAGRKQRMFVLKE
KENSSKKDVNVVKDEKKSLRKESVLSEESSLPYREKHTKSQSLSCQQTVQKDNPKMPISQ
SSSQVEETVSDSGTMLSTSSQASQHRYSCKKVASPEIKHSEFLAADVSSITSDYSTTSSS
VYITGLDASMMSPEVQSVTESKGEDADDERSELISEGRPMETDSESDFPVFATSSAAERL
SKGKVSEVFKSSRRNSEESEVSCTEGSSTPKLESRRLFSSHKLIECDTLSRRKSARHKTD
SEGSGDAKSEKDLPTVTKMFDIMKKGRSTSSLATSARSETDKQEPTWRLKITDRLKLRLK
SSADDMFGVGNQKTNSAETAKRKNIRRRHTLGGQRDFDEISVLNVWKVQEPSQSRERESE
LSAVNRLKPKCPAQDLSISEWLARERLRTSTTDLNTGETGKPRLENTSLADASKVDLPLS
AEVQADEGSSSSSLTSISRTPPSGPFQPPDQVNGESYQNMNKNNFSPAVDAHPHKLSGTQ
VVRSRFYQYL
Download sequence
Identical sequences ENSGALP00000041309 XP_015136865.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]