SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000041404 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000041404
Domain Number 1 Region: 181-304
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 6.54e-60
Family Dystroglycan, domain 2 0.000000556
Further Details:      
 
Domain Number 2 Region: 498-600
Classification Level Classification E-value
Superfamily Cadherin-like 2.04e-17
Family Dystroglycan, N-terminal domain 0.037
Further Details:      
 
Domain Number 3 Region: 61-159
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000107
Family Dystroglycan, N-terminal domain 0.0000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000041404   Gene: ENSGALG00000027710   Transcript: ENSGALT00000042864
Sequence length 896
Comment pep:known chromosome:Galgal4:12:2441415:2452604:-1 gene:ENSGALG00000027710 transcript:ENSGALT00000042864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVGCVPQPPFLGRTLLPVLLLAASARCHWPSEPAEVVRDWENQLEASMHSVLSDLRETV
PAVVGIPDSSAVVGRFFRVSIPTDLIASNGEAVQVSEAGKESLPSWLHWNAESSSLEGLP
LDTDKGVHYISVTTLQPFPNGSYVPQAANVFSVEVHQEDHSEPQSVRAAAQEAGDAAPFV
CGAEEPVTILTVILDADLTKMTPKQRIELLNRMRSFSEVELHNMKLVPVVNNRLFDMSAF
MAGPGNAKKVVENGALLSWKLGCSLSQNSVPNISKVEAPAKEGTMSARLGYPVVGWHIAN
KKPHLPKRMRRQINATPTPLTAIGPPTTAAQEPPTRIVPTPTSPAIAPPTETTAPPVREP
IPLPRKPTVTIRTRGPIVQTPTLGPIQPTRLVEGTGTVSVPIRPTVPGYVEPTAVITPPT
TTTKKPRVSTLKPATPSTTDSSTATTRRPTRRPKTPRPTKPPSTTRSTISKLTTASPPTR
VRTTASGVPRPWEPNEPPKLTNHIDRVDAWEGTYFEVKIPSDTFYDKEDTTTDKLQLTLK
LKEQQMIEENSWVQFNSTSQLMYGMPDRSHVGKHEYFMYATDKGGLFAVDAFEIHVHKRP
HGDKSPVKFKARLEGDHSAVANDIHKKIMLVKKLALAFGDRNSSTITVQDIAKGSIVVEW
TNNTLPLEPCPREQIRTLSKKIADDSGGPSPAFSNILQPEFKPLNVSVVGSGSCRHIQFV
PVTKDGRVISEATPTLAAGKDPEKSSEDDVYLHTVIPAVVVAAILLVAGIIAMICYRKKR
KGKLTIEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSMPET
TPLNQDTIGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences A0A1D5PFK3
ENSGALP00000041404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]