SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000041406 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000041406
Domain Number 1 Region: 178-274
Classification Level Classification E-value
Superfamily C-type lectin-like 1.37e-37
Family Link domain 0.0015
Further Details:      
 
Domain Number 2 Region: 286-369
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-26
Family Link domain 0.0038
Further Details:      
 
Domain Number 3 Region: 61-175
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000331
Family V set domains (antibody variable domain-like) 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000041406   Gene: ENSGALG00000026563   Transcript: ENSGALT00000045053
Sequence length 388
Comment pep:known_by_projection chromosome:Galgal4:28:3312673:3315920:1 gene:ENSGALG00000026563 transcript:ENSGALT00000045053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPPVPRCWWVLMAPLAPQMCPQGPWAALLLLVGVLASDTPPSARGRKKVVHVLEGDSGA
VVVQTAPGKVVTHRGGTIILPCRYHYDVSAHDPDEIRLKWTKVTEPMAFVDVFVALGKAR
RAFGSYRGRTALQEDGFGDASLIIRNVTLQDYGRYECEVTNELEDDTGMVKLDLEGVIFP
YHPRLGRYTLNFHEAQQACLQQDGILASHDQLHQAWLEGMDWCNAGWLQDGSVQYPISHP
REECGRKDTPVGVRNYGYRHKESEHYDAFCFTSNLNGKVYFLKTFRKLSYSEAVQACKNN
GAAVAKVGQLYAAWKIQLLDRCEAGWLEDGSIRYPIVNPRARCGGREPGVRNLGFPDKKY
KLFGVYCFKKAGDAPPEKKQGEGHPNRV
Download sequence
Identical sequences R4GH72
ENSGALP00000041406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]