SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000042385 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGALP00000042385
Domain Number - Region: 219-268
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0453
Family APC10-like 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000042385   Gene: ENSGALG00000026668   Transcript: ENSGALT00000045715
Sequence length 280
Comment pep:novel chromosome:Galgal4:Z:34151392:34267309:-1 gene:ENSGALG00000026668 transcript:ENSGALT00000045715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVKEMTKKKSELCILLLLIFLSALTGAYCGISLARVLWTEDFLQMLPLQTAPRPMNSG
NSLTEETQGIENQRNGVSYLAEERGTVMKDAQDLREAACVMPKEKCFTKCDRALKSAGVS
IDLQRSSRSAWHCRVAWLLCTQNVVDTFEQLDMSPGYCWRLKESQSQVVFNLPTKVQPTA
VTVQHSVETNLWHVSSAPRDFAVFGLDEEGEKEALLGKFTYDVRKEVTQTFQLQTETPRA
FWHIKLVVLNNWGNAGHTCIYRVQVHGKRAGTNDIGQGHV
Download sequence
Identical sequences ENSGALP00000042385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]