SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000042798 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000042798
Domain Number 1 Region: 420-574
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-25
Family SPRY domain 0.0077
Further Details:      
 
Domain Number 2 Region: 2-77
Classification Level Classification E-value
Superfamily RING/U-box 3.12e-16
Family RING finger domain, C3HC4 0.0092
Further Details:      
 
Domain Number 3 Region: 171-234
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000275
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000042798   Gene: ENSGALG00000028301   Transcript: ENSGALT00000045376
Sequence length 633
Comment pep:known_by_projection chromosome:Galgal4:18:4600169:4610827:1 gene:ENSGALG00000028301 transcript:ENSGALT00000045376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDKLLCSICLELFRVPVTLPCGHNFCERCINDHRSKQEQTADGAERGYKCPQCRSSCERQ
LELKKNVTLSEVVEVARASRSGPGSPPGSAGFSGTGPSGAESSPSEMAPGAEEEPGGEAE
LEEGTAAVLCDVCPEGDRAAAARSCLVCLASFCGAHLEPHRRSPAFRSHRLVAPLRRLEE
GLCPRHLQPLDGFCRAEQTCVCVRCRANEHRGHDVVSLEKERELKEAQRAKFLSSVDNEL
EELAVTIAQTRKMVELIKGVASKEKERVEKLFAEASELLATFQKEVAAFIEDSERSMLGE
TEADLRWKEERRAKLAQGKQNLENIPSTDTIYFLQEFQALKIAMEDNLSPAPSFQNELNF
TKCSQAVCAVKDALSAARKSQWDCLQGKGVDGMSFPKTEEAMTKSQFPDKSNNPACLESR
DYFLKFAFIIDLDSDTADKFIQLFGTKGAKRVLCPIPYPESPTRFINCEQVLGVNLMNRG
NYYWEVELIDGWVSIGVITEVFNPQDSYNHSRLGRNTSSCCLQWNGQNYAAWFGGLESVI
QQPFFHTIGVFLEYSEKALTFYGVKDSKMTCLKQLKAGSFAKAQSDPFQHKINQQFASLF
SFKLKPAFFLESVDAHLQIGPLKKDCVSVLKRR
Download sequence
Identical sequences ENSGALP00000042798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]