SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000042876 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000042876
Domain Number 1 Region: 351-489
Classification Level Classification E-value
Superfamily C-type lectin-like 1.22e-40
Family C-type lectin domain 0.00016
Further Details:      
 
Domain Number 2 Region: 1211-1353
Classification Level Classification E-value
Superfamily C-type lectin-like 7.7e-39
Family C-type lectin domain 0.00028
Further Details:      
 
Domain Number 3 Region: 933-1073
Classification Level Classification E-value
Superfamily C-type lectin-like 9.79e-39
Family C-type lectin domain 0.00038
Further Details:      
 
Domain Number 4 Region: 793-923
Classification Level Classification E-value
Superfamily C-type lectin-like 3.67e-38
Family C-type lectin domain 0.00049
Further Details:      
 
Domain Number 5 Region: 641-784
Classification Level Classification E-value
Superfamily C-type lectin-like 5.07e-37
Family C-type lectin domain 0.0000264
Further Details:      
 
Domain Number 6 Region: 500-637
Classification Level Classification E-value
Superfamily C-type lectin-like 1.37e-35
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 7 Region: 222-342
Classification Level Classification E-value
Superfamily C-type lectin-like 1.1e-29
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 8 Region: 1097-1211
Classification Level Classification E-value
Superfamily C-type lectin-like 2.7e-29
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 9 Region: 21-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.14e-27
Family Cysteine rich domain 0.0001
Further Details:      
 
Domain Number 10 Region: 152-210
Classification Level Classification E-value
Superfamily Kringle-like 1.51e-18
Family Fibronectin type II module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000042876   Gene: ENSGALG00000028304   Transcript: ENSGALT00000043091
Sequence length 1448
Comment pep:novel chromosome:Galgal4:2:19421328:19450218:-1 gene:ENSGALG00000028304 transcript:ENSGALT00000043091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVYLFVIFLFSFCTSLQMSDSGIFLIYNEDSKLCAQAQSSSSVITAMCNENNELQRFRW
ISATQLLSMGMKLCLAVLTQDDGAAITLETCNRTSKLQRWECKDEALSIQDKDLFLNYGT
GKGKKIRLSKESGKGSQWKIHGTAGSICSRPYEDIYTLGGNNFGAPCVFPFKFNDKWFAE
CIRKTDDASTLWCATTSDFDKDQRFGNCPLKDTLHKDFWKTNPLTETHYQINSNSLLTWH
QAKRSCQQQNAELLSVTNPHEEMFLLGLTSDLGFDAKLWTGLVRRLDSSWEWTEGSPLRY
LNWAPGNPSVELLKMCGTFQGRNGKWENVACNQKLGYICQKRNSSIVDDSFTVPSGDVKP
VKCPEEWVAYAGHCYRIYRTPKIWKQAQSSCRKEDGDLTSIHNVEEYSFIVSQLGYKPDD
ELWIGLNDFRFQMYFEWSDGTPVTYTKWQQRQPTHTPNKADCIVMNGEDGFWADSTCERK
LGYICKRKPLAEESGEAEVTYPGCQKGWMKHGFYCYSIGQLPATFSEAKLICEENKAHLA
TVRDRYEQAFLTSIIGFKPVKYFWIGLSDMEEQGTFRWAGGDPVIFTHWNMGMPGREPGC
VAMRTGTSAGLWDILNCEEKNLFLCKQLVEGATPPPPLTTPPPPSCPDEWQSIPQSSFCF
KIFQRGREKMQTWIGARDFCRAIGGDLACIHSEEEQKLISSLNKDYRHVSYWMGLNALGS
DGGFTWCDGSPVNFQKWANGEPNNYDGNEKCGVFYGYNDMKWNDMFCEHMQDYVCQIKKG
ATLKPEPTSTFDYEYIVSEDDWIIYNHKEYYFSKEEMPMEKAREYCKKNGGDLAIIENES
ERTFLWKYTFYKDRGNNFFIGLTVSLDKTFRWIDGSTVNYVAWAPNEPNFANNDENCVVM
YTQTGTWNDLNCGSVELFICERLNRTVRPSIAPTVPPPKGGCPEDWLLFDNKCFKAFGLN
ENYTLTWHAARNNCITSGGNLATISKKENQAFLMSLLKNTATDAWIGLNDINHEHTYLWT
DGSPVYYTNWAKGSRSYYSKDDCVYMKKNPIEQAGKWKDGDCKASKSYICQKNTDPKLQS
SQAVVPMFGFNNYDDDRYAVINYKMNWEEAQKNCKDQHADLASILDPYVEAYLWLQTLKH
GEPVWIGLNSNTTHGLYMWSDRRRSRYHNWASGEPNKNAACAYLDLDGFWKTTSCNETFL
SLCKQSDELIPTESPQLPGKCPEPKQGRSWIPFRGHCYYVHTTSEASWPAASMMCIQMGA
SLVSIEDPAEMNFLLLYLSPFASDNRKFWIGLFKNIEGEWMWSDRSVVEFVNWEKGEPTV
MYDKHCVHMDVSSGAWRNYYCSVDRNFICKIPKIIEVEPTHDSSVSQASKREAAVSSSHS
RAVMIVTLIFLLLAGTGLIVYFFYKKRREQTTVTASFGNAIYCGTPDPGTHESKCLVTNI
EENEQAML
Download sequence
Identical sequences R4GL09
XP_001235106.3.86415 ENSGALP00000042876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]