SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000043151 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000043151
Domain Number 1 Region: 170-239
Classification Level Classification E-value
Superfamily Homeodomain-like 6.42e-18
Family Homeodomain 0.0000519
Further Details:      
 
Domain Number 2 Region: 44-110
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000488
Family LIM domain 0.026
Further Details:      
 
Domain Number 3 Region: 14-42
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000122
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000043151
Domain Number - Region: 107-134
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00109
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000043151   Gene: ENSGALG00000014884   Transcript: ENSGALT00000044538
Sequence length 349
Comment pep:known chromosome:Galgal4:Z:15002784:15016470:1 gene:ENSGALG00000014884 transcript:ENSGALT00000044538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDETCTCFV
RDGKTYCKRDYIRLYGIKCAKCSIGFSKNDFVMRARAKVYHIECFRCVACSRQLIPGDEF
ALREDGLFCRADHDVVERASLGAGDPLSPLHPARPLQMAAEPISARQPALRPHVHKQPEK
TTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRS
IMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDFALQ
SDIDQPAFQQLVNFSEGGPGSNSTGSEVASMSSQLPDTPNSMVASPIEA
Download sequence
Identical sequences P50211
NP_990745.1.86415 XP_005152018.1.78019 XP_005242057.1.75256 XP_010561834.1.12557 XP_011595199.1.59079 XP_015704180.1.68032 XP_021237301.1.32913 ENSGALP00000038117 ENSGALP00000043151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]