SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000000070 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000000070
Domain Number 1 Region: 147-240
Classification Level Classification E-value
Superfamily PH domain-like 9.86e-29
Family Pleckstrin-homology domain (PH domain) 0.0000102
Further Details:      
 
Domain Number 2 Region: 13-117
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-24
Family SH2 domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000000070   Gene: ENSGALG00000000056   Transcript: ENSGALT00000000071
Sequence length 262
Comment pep:known chromosome:WASHUC2:4:61725647:61750259:1 gene:ENSGALG00000000056 transcript:ENSGALT00000000071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQRREPSAHLDEELRALGWYHYNLTRHAAEALLLSNGKDGSYLLRKSNEREDLYSLSVR
GKDSVKHFHVEYTGTSLKFGFNEFSSLKELVMHFANQPLIGSETGTLIVLKHPYPHKVEE
PSIYESVRVHTAMQTGRTENDLVPNAPSLGTKEGYLIKQGKIVKNWKTRWFTLHRNELKY
FKDQTATEPIRALDLTECSAVQFDYSQERVNCFCLVFPLRTYYLCAKTGIEADEWIKILR
WKLSQIRKQVEQRSGPTSQLHP
Download sequence
Identical sequences A0A1D5P421
9031.ENSGALP00000000070 NP_001012951.2.86415 ENSGALP00000000070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]