SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000000207 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000000207
Domain Number 1 Region: 23-116
Classification Level Classification E-value
Superfamily Immunoglobulin 1.43e-21
Family I set domains 0.0051
Further Details:      
 
Domain Number 2 Region: 119-212
Classification Level Classification E-value
Superfamily Immunoglobulin 4.18e-21
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000000207   Gene: ENSGALG00000000152   Transcript: ENSGALT00000000208
Sequence length 267
Comment pep:known chromosome:WASHUC2:Un_random:35638888:35640079:-1 gene:ENSGALG00000000152 transcript:ENSGALT00000000208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPMVVNLILGWWLVAVSRAQKLPRPSLSLHPSQGASLGDNVTLRCHLPQPAAWVRLYRY
QNPTYIEQKDNVQDMAEFSLTSIKQEDAVIYQCQYQGLAPAGTSQKSDPMELLVTDHRYP
PPGISLSPKEHVEMGSKITIQCWNKEYGAAFLLHKAGHSAPIQDQEPDDGGTATFTLFGV
TPADSGTYRCSYRIGGCCLLFSPLGDNVTLEVIPRPAPPGGNGGASRDLVAVVAGRWVAA
IVFIIILTISVLLVAQRRQMQSDLRPG
Download sequence
Identical sequences ENSGALP00000000207 NYSGRC-IgSF-ENSGALP00000000207 9031.ENSGALP00000000207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]