SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000000448 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000000448
Domain Number 1 Region: 2-196
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.63e-47
Family Ankyrin repeat 0.0000000733
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000000448   Gene: ENSGALG00000000336   Transcript: ENSGALT00000000449
Sequence length 878
Comment pep:known chromosome:WASHUC2:26:663583:682661:-1 gene:ENSGALG00000000336 transcript:ENSGALT00000000449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QACIDENLDMVKFLVENGANVNQQDNEGWTPLHAVASCGYLNIAEYLISHGANVAAVNSE
GEVPSDIAEEAAMKDLLLEQVKKQGVDLDLARKEEEQQMLQDARQWLNSGRIEDVKQPQT
GATALHVASAKGYSEVMRLLIQAGFNLNVQDNDGWTPLHAAAHWGVKEACSILAEALCDM
DVRNKLGQTPFDVADEGLVEHLEMLQKKQTVLRSEKETRNKLIEADMNGKPQSGVFMNKE
KILYEEDRLKTTEMEEENKDSSSSSSEEEEEAEEDEVSESDAEKESERKEESFANHSSHE
TRPSITEQIPPPESNSFTASARRFSWLNRSDEQKDESPSSWRLGLRKTGSHNTLSEVTAT
REAQRDKAASIYRSSSTPRISALLDSKEKDKENKSYLATIAPRRLSSASDIEEKENSRES
AANIVRSGSYTRQPWRDESKGNEAPHSGAPPTYVSTYLKRAPFRQQTDSAVEKSTEGLSA
STPLGVITNRAVRGSANGTASAGAASTTGKDCSAEEARERRRSYLTPVRDEEAESLRKAR
SRQARQTRRSTQGVTLTDLQEAERTFSRSRAERQAQEQQSEKAESAEPAEDSSERQETRT
RWSRNTDEETVYRRLRCPVQADKPTTPVSPSTSAPLLYTSSYLTRTNKYLGLDSGNPADF
RGAATEMEKNAWPECEDADVDDRSANKQSIRERRRPKERRRGTGIIFSTKDDDDDIDGNE
EVKETRHERLSRLEAATTPATSDSYSDRASSRSSAYSRRENRLAALSSRAEEESNRDYKK
LYESALSENQKLKSKLQEAQLELADIKSKLEKAAQQKHEKTSDRSSMLEMEKREKRALER
KLSEMEEEMKILTELKSDNQRLKDENGALIRVISKLSK
Download sequence
Identical sequences 9031.ENSGALP00000000449 ENSGALP00000000448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]