SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000001645 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000001645
Domain Number 1 Region: 1039-1366
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.09e-82
Family Ankyrin repeat 0.0000067
Further Details:      
 
Domain Number 2 Region: 365-686
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.73e-82
Family Ankyrin repeat 0.0000069
Further Details:      
 
Domain Number 3 Region: 194-393
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.45e-52
Family Ankyrin repeat 0.00015
Further Details:      
 
Domain Number 4 Region: 1684-1755
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.82e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000001645   Gene: ENSGALG00000001099   Transcript: ENSGALT00000001647
Sequence length 2531
Comment pep:known chromosome:WASHUC2:13:1443501:1544367:1 gene:ENSGALG00000001099 transcript:ENSGALT00000001647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTDGTAAPLGDEEIDSVAPRAPPAAEPPAAAGPSPLGLRAVRLFGEAGPGGPGGPGAPA
AGEAALDFKLAAAVLRSGGGGGGSGSDEDEVSEVESFILDQEDLDNPVLKTTSELFLSGA
AEGADLRAVDPETQARLEALLEAAGIGKLSTADGKAFADPEVLRRLTSSVSCALDEAAAA
LTRMRAENNHNAGQVDNRSLAEACSDGDVNAVRKLLDEGRSVNEHTEEGESLLCLACSAG
YYELAQVLLAMHANVEDRGNKGDITPLMAAASGGYVDIVKLLLVHCADVNAQSSTGNTAL
TYACAGGFVDIVKVLLKAGANIEDHNENGHTPLMEAASAGHVEVARVLLEYGAGINTHSN
EFKESALTLACYKGHLDMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGA
QVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVAL
LLAQGANINAQTEETQETALTLACCGGFSEVADFLIKAGADIELGCSTPLMEAAQEGHLE
LVKYLLAAGANVHATTATGDTALTYACENGHTDVADVLLQAGADLEHESEGGRTPLMKAA
RAGHLCTVQFLISKGANVNRATANNDHTVVSLACAGGHLAVVELLLAHGADPTHRLKDGS
TMLIEAAKGGHTNVVSYLLDYPNNVLPVPTADLSQLTSPSQDQSQVPRVPVHTLAMVVPP
QEPDRTPQENSPPLVGVVKGASKQKSSSLQVADKDLLPPFHPYQPLECIVEETEGKLNEL
GQRISAIEKAQLKSLELIQGEPLNKDKIEELKKNREEQVQKKKKILKELQKVERQLQMKT
QQQFTKEYLETKGQTDTPLPLQQQCPLTGVFPEVEADKGLPEDNFSELPQVDTILSKDDE
QQQSPPPAEQIEFVPIQPLPAPQCNFSGNLGYNGTESLELQKAIGNQQNVGQQQQIAGQG
LLVQEPDGLMVATPAQTLTDTLDDLIAAVNSRVPSGSTGSLHTTESPTPEPCSQASSNVA
SQSVLPMYPSVDIDAHTESNHDTALTLACAGGHEELVSVLIARGANIEHRDKKGFTPLIL
AATAGHVGVVEILLDKGGDIEAQSERTKDTPLSLACSGGRQEVVDLLLARGANKEHRNVS
DYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHVPAVKLLLDMGS
DINAQIETNRNTALTLACFQGRAEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGR
VLLDKGADVNAPPVPSSRDTALTIAADKGHYKFCELLINRGAHIDVRNKKGNTPLWLAAN
GGHYDVVQLLVQAGADVDAADNRKITPLMSAFRKGHVKVVQFLVKEVNQFPSDIECMRYI
ATITDKDLLKKCHQCVETIVKAKDQQAAEANKNATILLKELDLEKSREESRKQALAAKRE
KRKEKRKKKKEEQKRKQEEDEENKPKETLELHEDDDEEENDEEVEQEVPIEPPSATTTTT
IGISATSATFTNAFGKKRANVVTTPSTNRKNKKNKTKETPQNMQIILPDQHISLAQQKAD
KNKINGEPRGGGASGNSDSDNLDSTDCNSESSSGGKSQELNFTMDTNSSERRYASLLIPS
QEEKTSTSASKAPTRLDGEGNSNSLSTTYKPVSLPLTSPNVKLNLTSPKRGQKREEGWKE
VVRRSKKLSVPASVVSRIMGRGGCNITAIQDVTGAHIDVDKQKDKNGERMITIRGGMEST
RYAVQLINALIQDPAKELEDLIPKTHIRTPASSNKSIHANFSSGVSTASASNKNSFPLGA
PPLVTSQSSTLSTFQPTNKLNKNVPANVRSSFPVSLPLAYSHPHFALLAAQTMQQIRHPR
LPMAQFGGTFSPSPNTWGPFPVRPVNPGSTNSSPKHNSSSRVGSQNGNILQTESPGLATS
SPITVSSVVASTQPLCATSNRTPSSVRKQLFACVPKTSAAATAISTVTNTCSTLPSASSA
PPNNGQVPAAFLPSTAPQTQHSALKADSFSAVSAPKEKVSTPDQPVGNTCTPSSIAGSSS
MSASSNSGVTEAHPSSSPAPLMNTQDEILPASMSEMSPSMSASISSSSEPAPLSLASPRS
VVADNQDNSNLPQVAVPAPRVTHRMQSRGSFYSVVPNANLHQDPQSIFVTNQVPLTPSQG
PPAAVQLSSAMNVMNGSQMHINPANKSLPPTFGPATLFNHFSSLFDSNQVPSNQGWGDCP
LSTRAAADPSYTVQSTFLNNSMLGHVENVHPDNSKAPGFRPPSQRVSTSPVGLPSIDPSN
SSTTSSSGPLTGFSANMQGARVYLQGPAPVGTPSFNRQHFSPHPWTSATNSSASAPSNLS
QPKTGNTNQDRKVPPPIGTERLARIRQGGSVTPTPLGTNFTAPVGHSGIWSFGVNSVSEG
LSGWSQPVMGNHPMHQQLSDPGTFSQHQPMERDDSGIVAPSNIFHQPMPNSFVDFSKGLP
ISMYGGTLIPSHPQLADGPGGPLFNGLHTPDPAWNPMIKVVQNSTECTDAQQIWPGTWAP
HIGNMHLKYVN
Download sequence
Identical sequences 9031.ENSGALP00000001645 ENSGALP00000001645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]