SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000002230 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000002230
Domain Number 1 Region: 436-712
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.27e-67
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 2 Region: 6-79
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 1.7e-22
Family Mib/herc2 domain 0.00089
Further Details:      
 
Domain Number 3 Region: 66-146
Classification Level Classification E-value
Superfamily RING/U-box 2.59e-22
Family ZZ domain 0.0095
Further Details:      
 
Domain Number 4 Region: 151-223
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 3.79e-22
Family Mib/herc2 domain 0.001
Further Details:      
 
Domain Number 5 Region: 896-951
Classification Level Classification E-value
Superfamily RING/U-box 0.00000432
Family RING finger domain, C3HC4 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000002230
Domain Number - Region: 830-872
Classification Level Classification E-value
Superfamily RING/U-box 0.0118
Family RING finger domain, C3HC4 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000002230   Gene: ENSGALG00000001473   Transcript: ENSGALT00000002232
Sequence length 956
Comment pep:known chromosome:WASHUC2:21:2025875:2048268:-1 gene:ENSGALG00000001473 transcript:ENSGALT00000002232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLDPYASMQVGMRVVRGVDWKWGSQDSGEGNVGTVVEIGRTGSPTTPDKTVVVQWDQGN
RTNYRTGFQGAYDLLLYDNAQIGVRHPNIICDCCKKHGIRGMRWKCKMCFDYDLCTQCYM
NNKHDLSHAFERYETAHSQPVLVSPRQNLTRITLKGTFQGAKVVRGPDWEWGNQDGGEGK
TGRVVDIRGWDVETGRSVASVTWSDGTTNVYRVGHKGKVDLKCTVEASGGFYYKEHLPKL
GKPAELQRKESTDRHPFQHGDKVKCLLDIDILREMQEGHGGWNPKMAEFIGQTGTVHRIT
DRGDVRVQFNSETRWTFHPGALTKLNTFWVGDVVRVIDDMETVKRFQPGHGEWTDEMAPT
LGHIGKVIKVYGDGDLRVSVGDQSWTFNPACLTAYQRDEEANLMTTENAKESKSTLITVL
EKLLSQKTESDHAGCLVIWAALNNAAKVRELLQKYPDKAKVDNKNQGRTALQIASYQGHL
DVVKILLQAHATVNLRDEEGDTALHYAAFGNQADVARVLMAKGAGADLLNNAKCTALYVA
VSQGFTEVVQALCELNCDVNLPDSHGDTPLHYAITADYKVIIEILTEVPNIDFTVQNCQG
FNLLHYSALKGNKLAIKKILARARQLVDSKKEDGFTALHLAALNNHKEVAEILIKEGRCD
VNVKNNRNQTPLHLAIIQGHVGLVQLLVSEGSDVNAEDEDGDTAMHIALERQQLMSVLME
KREGEMGSSLFSKLQASGFLGNVELNVGTAIACYLAQEGADINYANHRGKSPLDLITDGR
IVQIIKDFSQKFREQQVSSDCSAITCSLRRVHTTPNTMTNLSVSSVAVPTECLVCSELAL
LIHFFPCQHSIVCEECSRRMKKCIKCQVTITKKLKQDSTEVECSPSSESTDQRKLMEELQ
NRYRQMEERITCPICIDDQIKLVFQCGHGSCPDCSTALTVCPICRQAIRERIQIFV
Download sequence
Identical sequences 9031.ENSGALP00000002233 ENSGALP00000002230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]