SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000003527 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000003527
Domain Number 1 Region: 21-118
Classification Level Classification E-value
Superfamily Immunoglobulin 3.8e-36
Family V set domains (antibody variable domain-like) 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000003527   Gene: ENSGALG00000022032   Transcript: ENSGALT00000003533
Sequence length 118
Comment pep:known chromosome:WASHUC2:Un_random:56289551:56290292:1 gene:ENSGALG00000022032 transcript:ENSGALT00000003533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTAMQMVMVMSMNMGLMAAVTLDESGGGLQTPGGGLSLVCKVSGFFSFSSYAMMWVRQT
PSKSLEWVAGISGAGSSTWYATAVKGRATISRDNGQSTVRLQLNNLRAEDTATYYCTR
Download sequence
Identical sequences 9031.ENSGALP00000003527 ENSGALP00000003527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]