SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000003677 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000003677
Domain Number 1 Region: 225-300
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.46e-23
Family PHD domain 0.00031
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000003677
Domain Number - Region: 153-208
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00273
Family PHD domain 0.021
Further Details:      
 
Domain Number - Region: 84-124
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0127
Family PHD domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000003677   Gene: ENSGALG00000001908   Transcript: ENSGALT00000003684
Sequence length 300
Comment pep:known chromosome:WASHUC2:19:4775905:4777919:1 gene:ENSGALG00000001908 transcript:ENSGALT00000003684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRLLTVTSQCAGLPHTAHARVPPFPASSGSRCGLCKRTDYDPDIYGETCRQDRLCVHENC
LYHASGLYQHGADDEGFFGFLLPDIEQALQRVAEKVCCVCRRRGASVRCHRRRCSRTFHY
PCGRERGCVSQFFGEYRSFCWQHRPTQQVQLLRQQHPQCAICLEAVEGRPSYNTLICPSC
TSAHFHRHCIQGQALRAALHHFRCPLCQDMQTFQAEMFRLGIKIPDRDAAWEEEGAFNEL
YQRHNSCDASLCLCSLGRDYSNNTGPWRMLLCSSCASCGTHQRCSAIPEDAESWECSGCS
Download sequence
Identical sequences ENSGALP00000003677 9031.ENSGALP00000003677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]