SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004676 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004676
Domain Number 1 Region: 1574-1766
Classification Level Classification E-value
Superfamily SET domain 2.49e-52
Family Histone lysine methyltransferases 0.0051
Further Details:      
 
Domain Number 2 Region: 1457-1587
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 8.42e-26
Family PWWP domain 0.0000245
Further Details:      
 
Domain Number 3 Region: 9-139
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.19e-16
Family PWWP domain 0.018
Further Details:      
 
Domain Number 4 Region: 1405-1474
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000115
Family PHD domain 0.0038
Further Details:      
 
Domain Number 5 Region: 1811-1878
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000031
Family PHD domain 0.0066
Further Details:      
 
Domain Number 6 Region: 1250-1298
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000115
Family PHD domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004676   Gene: ENSGALG00000002971   Transcript: ENSGALT00000004685
Sequence length 2205
Comment pep:known chromosome:WASHUC2:13:10292987:10332746:-1 gene:ENSGALG00000002971 transcript:ENSGALT00000004685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKIRAKKKPTPVKYEVGDLVWAKFNRRPWWPCTICHDPVLDCHSKMKVSNRRPYREYYVD
PLGEPSEKAWVAGKAIVLFEGRHQFEELPVLRRRGKQKEKGYKHKVPQRFMAKWEVSVGQ
AEDMLLGGPEDQKCSQNSSELDSEKEVQSEYYSNGPGAKKDRQLNGCFKSLAFDSKHSAN
EKGKSHIKPHMKKSSESRKRTRVKKSGMREEASKGEIQEETPESIVNNMIVGDLPEKHAS
HELRRIAKSITASNSTRENHLLSSFGERRFENITLKSDYGSHKSDALKNTLQGDLFSNAS
LEREKSSLGILCSSKLQIHYSASEAGVEKKQTESDSSSSLSDGGNSDVDTMDQSSERASS
TLEVSDSSDKMEKEFPMTSSGNIKLSMYFSQKSSRRARKKSYRDRKPLGGLVTSRLDAEF
AHRELEGGSSDAEMSLTALECSSDVRNDNLSLANKHATPQSVSKDSSWSAVANQTTLKLK
NMKLPRIRSIKCKHKEKVAGLEPSLAEEESGMNHCSSDTKGFSGLQRDSLQRSGKADGQK
LLNNVHEKPRDSAEIETAVVKHVLSELKELSYRSMNDDVGDSGTPKATVPLLFSSASGHG
RLPIEPNYRFSTLLMMLKDIHDSKAKEQQLMTGQNIVPYRNTGTADGSGGNSASSLTSLS
IVGPPFKIEKNGDCAQETVSPNSSSISNSSFSRNPPAKLPGSGTGKREPANAAVSGTNGT
NCVPKRNCSKSKQSTKLGDKTVSNRKDLKPGGPSKFLSRLSRDSGEHAFRVHGSVASPLG
NEAEDTERKESVDLTEHSTDEDSACLSDDNLGRIGRRPEAGRNTERCASAENGESPDLDS
EANSESSLGDEANDVNHVAPKKRWQRFNQSSARSNKHISRSREKGNLESAFGLNSHGFSL
KGNECLGRRHSPHSKVLEADLTVQDYENHLDLVEKRLNVCGKPNNSVMDSETKLGNFAPQ
SEFSAQVLHSERKRLRKPSKRLLEYAEEYDHLFAPKKKSRKSQEQLRKVNSVARSGFEGG
LPAQRSPDRETQRGPSPLVSTPFSTKESPPILEAECSFSELEPHASDPSEQLIEGQSDFP
ELVLSSSDVSEVSASPDAEERFLKNSIAGNFESKRQRKPTKKLLESNDLDTAFMPKKEEW
TPPKKSFGTGPSESDSLELYSPAHFPDLGEASEKLLEKQRKRKRPRHSSAAVHSKKEKNG
ERLGETPRSEGETLVHGTSTSPKGGHEDGSENDHGVPSSKKIQGERGGGAALKENVCQIC
EKPGELLLCEAQCCGAFHLQCLGLSEMPTGKFICNECSTGVHTCFVCKNCGQDVKRCLLP
LCGKYYHEECIQKYPPTVTQNKGFRCSLHICMTCHAANPTNISASKGRLMRCVRCPVAYH
SNDFCLAAGSVVLASNSIICPNHFTARRGCRNHEHVNVSWCFVCSEGGSLLCCESCPAAF
HRECLNIEMPEGSWYCNDCKAGKKPHYKEVVWVKVGRYRWWPAEICHPRTIPVNIQKMKH
DIGEFPVLFFGSKDYLWTHQARVFPYMEGDVSSKDKMGKGVDGIYKKALHEAAVRFEELK
AQKELRQLQEDKKNDKKPPPYKHIKVNRPVGKVQIFTADLSEIPRCNCKPTDENPCGLDS
ECINRMLLYECHPLVCPAGERCQNQCFSKRQYPEVQIFRTLARGWGLQAKTDIRKDGWVY
EYTRILKRSEFCNLRIPYRRQKSGSGIASATLEDRIIDAGPKGNYARFMNHCCQPNCETQ
KWCVNGDTRVGLFAIVNIKAGSSLTFENFGLYLQCFGNRNTVAGNGGMAGGCANTLSVPQ
SQPTLSEEKSKKLKRRPQMKRRSQAEVMKEREDECFSCGDGGQLVSCKKAGCPKVYHADC
LNLTKRPAGKWECPWHQCDMCGKEAASFCEMCPRSFCKQHREGMLFISKLDGRLSCTEHD
PCGPNPLEPGEIREYVPPMGALTNGDDTQPLPQSVAFKLQSPEKPPATLALRLPPSEKPP
TTLALRVQPSNKPPTTLALRLPPPDKPPAALALRLPPSNKPPTTLSLRLKPSNKPPTTLS
LRLQPSDKPPTTLSLRLQPSDRSQPVDEPPVAEQPQLLSKASAQSPQPQPAEKSPSSAIP
HIPASEEILSPDATWPQASDKLATAVAPRPQALDKPPAASAPRLLLSEKALRPVDQNAQP
KERGAPAAELSPQQKPSWEVASVPAEQTPWTSERLRVFEQTPRPA
Download sequence
Identical sequences ENSGALP00000004676 9031.ENSGALP00000004690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]