SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004748 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004748
Domain Number 1 Region: 121-173
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000635
Family Ankyrin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004748   Gene: ENSGALG00000018651   Transcript: ENSGALT00000004757
Sequence length 289
Comment pep:known chromosome:WASHUC2:28:2669519:2674269:-1 gene:ENSGALG00000018651 transcript:ENSGALT00000004757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGEEEAPVNDGDNRELLKEEIENGAEGAAATEEPAGTRDTGDGGAPPGLLQMDRGLQGS
SCMEGGTNALLKPSAASTDRQRTPELSTLDSFPLKHSNTLTNRQRGNEISALPATLDTLS
IHQLAAQGELNQLKKHLQKGENLVNKPDERGFTPLIWAAAFGEIETVRHLLEWVRPHVHS
TSLSMRMGPGGVSPPTSIPVGVLGLPTPILIGRDGGGLVQLVVRGQDAVLLQARLLRLVE
TAREIKMGPIPLFPFQISAVLAAGLGQPSLVQQVIENHILKLFQNKGLE
Download sequence
Identical sequences ENSGALP00000004748 9031.ENSGALP00000004748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]