SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000005205 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000005205
Domain Number 1 Region: 223-301
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.07e-22
Family PHD domain 0.00031
Further Details:      
 
Domain Number 2 Region: 150-212
Classification Level Classification E-value
Superfamily RING/U-box 0.000000671
Family RING finger domain, C3HC4 0.024
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000005205
Domain Number - Region: 88-123
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000288
Family PHD domain 0.062
Further Details:      
 
Domain Number - Region: 24-63
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00882
Family PHD domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000005205   Gene: ENSGALG00000003685   Transcript: ENSGALT00000005214
Sequence length 315
Comment pep:known chromosome:WASHUC2:12:2692909:2697949:-1 gene:ENSGALG00000003685 transcript:ENSGALT00000005214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NKKILKKKHHKRITLSPSLAKILFSVSETVCWLCGRVDDDSSILGHKHEDNGFYFHTFCV
IFSTGLCQPGKDNTNVCSFKEDLIRTVRQAEQTLCFVCGNFGATITCAEAGCDRSFHLPC
ASEGDCITQYFGEFRSFCWEHLPHQPVETAPTQDTTCIICMEPVGDSRSYSTMVCPSCQH
AWFHRACIQGMAKSAGLRCFQCPLCRDRERFIQEMINLGIHIPVRKPKWETNRAYASLAV
RHRHCDASNCLYPQGREQAEREGPWQLLLCSSCAAQGTHRCCSNLGQSTTSWECNACAGE
GTAGGVSDNLGTSLC
Download sequence
Identical sequences 9031.ENSGALP00000005205 ENSGALP00000005205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]